CAZyme Information

Basic Information
SpeciesVitis vinifera
Cazyme IDGSVIVT01029771001
FamilyAA2
Protein PropertiesLength: 299 Molecular Weight: 32435.8 Isoelectric Point: 8.3247
ChromosomeChromosome/Scaffold: 12 Start: 14448034 End: 14449637
DescriptionPeroxidase superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA2402970
  AAHFQSDPAIARGLLRMHFHDCFVRGCDASILINGTSTEKTTTPNSLLKGYDAIDDAKSQIEDVCPGVVSCADILALAARDAVVLTNGPRWLVLTERRDG
  RVSLASDTNNLPGFTESIASQKKKFADKGFNDQDLVTLVGGHTIGTAACQSFRYRLYNCSNTSANGGDPCMDAAFVSQLQKMCPANRDGSKRIALDTGSS
  DRFGGSFFTNLRNGRGILESDWKLRTDASTRAYVQRFLGLRGELNFNMEFGRSIVKMS
Full Sequence
Protein Sequence     Length: 299     Download
MFVFLLLAKA FALVHGQGTR VGFYSASCPQ AEFIVQLTVA AHFQSDPAIA RGLLRMHFHD    60
CFVRGCDASI LINGTSTEKT TTPNSLLKGY DAIDDAKSQI EDVCPGVVSC ADILALAARD    120
AVVLTNGPRW LVLTERRDGR VSLASDTNNL PGFTESIASQ KKKFADKGFN DQDLVTLVGG    180
HTIGTAACQS FRYRLYNCSN TSANGGDPCM DAAFVSQLQK MCPANRDGSK RIALDTGSSD    240
RFGGSFFTNL RNGRGILESD WKLRTDASTR AYVQRFLGLR GELNFNMEFG RSIVKMSN*     300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00141peroxidase0.00124827629+
cd00314plant_peroxidase_like1.0e-2135298282+
pfam00141peroxidase3.0e-6135183150+
cd00693secretory_peroxidase8.0e-13720298282+
PLN03030PLN030302.0e-17115298286+
Gene Ontology
GO TermDescription
GO:0004601peroxidase activity
GO:0006979response to oxidative stress
GO:0020037heme binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN63424.1022986305hypothetical protein [Vitis vinifera]
EMBLCAN63698.10122984292hypothetical protein [Vitis vinifera]
RefSeqXP_002269063.1012981298PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002269270.10429813309PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002272847.1022986305PREDICTED: hypothetical protein [Vitis vinifera]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1sch_B0232986275A Chain A, Peanut Peroxidase
PDB1sch_A0232986275A Chain A, Peanut Peroxidase
PDB1qo4_A0232987285A Chain A, Peanut Peroxidase
PDB1pa2_A0232987285A Chain A, Arabidopsis Thaliana Peroxidase A2
PDB1qgj_B0232986282A Chain A, Arabidopsis Thaliana Peroxidase N
Metabolic Pathways
Pathway NameReactionECProtein Name
betanidin degradationRXN-8635EC-1.11.1.7peroxidase
Signal Peptide
Cleavage Site
16
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CU575170285152970
CU609985286152980
CK264108277162900
CK264523268162830
CK245104269322980
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_001_00892.1Aquca_007_00386.1Aquca_007_00388.1Aquca_022_00275.1
Arabidopsis lyrata870602919714919715496608494031
329078316625316622351860920775
Arabidopsis thalianaAT2G41480.1AT5G64110.1AT5G39580.1AT5G64120.1AT5G64100.1
AT4G25980.1AT1G77100.1AT5G39580.2
Brachypodium distachyonBradi2g04490.1Bradi4g22660.1Bradi4g40680.1
Brassica rapaBra000228Bra016930Bra024268Bra031934Bra024269
Bra028436Bra024267Bra013938Bra031933Bra015695
Bra008291
Carica papayaevm.model.supercontig_42.86evm.model.supercontig_468.4evm.model.supercontig_468.3evm.model.supercontig_75.24evm.model.supercontig_49.72
evm.model.supercontig_42.87evm.TU.contig_36964.1evm.model.supercontig_845.4
Capsella rubellaCarubv10023605mCarubv10007711mCarubv10026774mCarubv10026761mCarubv10027924m
Carubv10021650mCarubv10007281m
Citrus clementinaCiclev10008925mCiclev10001751mCiclev10003869m
Citrus sinensisorange1.1g020511morange1.1g045530morange1.1g019638morange1.1g041705m
Cucumis sativusCucsa.217820.1Cucsa.292700.1Cucsa.217830.1Cucsa.345800.1Cucsa.292740.1
Cucsa.292700.2
Eucalyptus grandisEucgr.I02673.1Eucgr.L02460.2Eucgr.L02460.1Eucgr.L02460.4Eucgr.L02460.3
Eucgr.G00658.1Eucgr.F04267.1Eucgr.L01488.1Eucgr.L02460.6Eucgr.L02460.5
Fragaria vescamrna13503.1-v1.0-hybridmrna10707.1-v1.0-hybridmrna31037.1-v1.0-hybridmrna02015.1-v1.0-hybridmrna10709.1-v1.0-hybrid
mrna17058.1-v1.0-hybrid
Glycine maxGlyma08g19170.1Glyma13g23620.2Glyma06g28890.1Glyma15g05810.1Glyma15g05820.1
Glyma08g19180.1Glyma08g19340.1Glyma15g05650.1Glyma1655s00200.1Glyma15g05831.1
Gossypium raimondiiGorai.002G013000.1Gorai.012G141300.1Gorai.005G219200.1Gorai.005G219400.1Gorai.005G219100.1
Gorai.009G017700.2Gorai.009G017700.1Gorai.012G141500.1Gorai.012G141500.2Gorai.002G208800.1
Linum usitatissimumLus10007051Lus10012684Lus10007052Lus10020826Lus10015555
Lus10028631Lus10020421Lus10007050Lus10018929
Malus domesticaMDP0000298078MDP0000198353MDP0000184865MDP0000299137MDP0000515971
MDP0000684133MDP0000136412MDP0000493703MDP0000843352MDP0000527985
MDP0000139136
Manihot esculentacassava4.1_011950mcassava4.1_032385mcassava4.1_024068mcassava4.1_011945mcassava4.1_029449m
Medicago truncatulaMedtr4g114450.1Medtr4g114210.1Medtr2g008710.1Medtr2g008730.1Medtr2g008160.1
Medtr2g008710.2Medtr2g008160.2
Mimulus guttatusmgv1a009839mmgv1a023088mmgv1a019228mmgv1a018852m
Oryza sativaLOC_Os01g07770.1LOC_Os11g10460.1LOC_Os12g08920.1
Panicum virgatumPavirv00006707mPavirv00035647mPavirv00001257mPavirv00018071mPavirv00058650m
Pavirv00013421m
Physcomitrella patensPp1s22_167V6.1Pp1s22_159V6.1
Phaseolus vulgarisPhvul.006G207100.1Phvul.009G197100.1Phvul.003G164600.1Phvul.006G209100.1
Picea abiesMA_93867g0010MA_10426026g0010MA_10429595g0010MA_10434825g0010MA_9805677g0010
Populus trichocarpaPotri.006G069600.1Potri.018G131600.1Potri.016G125000.1
Prunus persicappa008723mppa008667m
Ricinus communis28320.m00113629989.m00043230174.m00915527985.m000888
Setaria italicaSi002216mSi026601mSi010572m
Selaginella moellendorffii10494613291523327112210075799
8986123609714593212686397402
13675973829123452
Sorghum bicolorSb03g004380.1Sb08g005520.1Sb05g009400.1
Thellungiella halophilaThhalv10016924mThhalv10004567mThhalv10004581mThhalv10004557mThhalv10019514m
Thhalv10025604m
Vitis viniferaGSVIVT01015537001GSVIVT01015533001.522.787GSVIVT01015533001.522.787GSVIVT01015533001.49.309GSVIVT01015533001.49.309
GSVIVT01029748001GSVIVT01029776001GSVIVT01029774001GSVIVT01029775001GSVIVT01029773001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)