Basic Information | |
---|---|
Species | Vitis vinifera |
Cazyme ID | GSVIVT01030031001 |
Family | GH28 |
Protein Properties | Length: 164 Molecular Weight: 17264.5 Isoelectric Point: 4.8093 |
Chromosome | Chromosome/Scaffold: 12 Start: 9003706 End: 9004468 |
Description | Pectin lyase-like superfamily protein |
View CDS |
External Links |
---|
NCBI Taxonomy |
Plaza |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH28 | 2 | 163 | 0 |
GRSTGVNISDAIIKTGDDSLSIGDGSQHINVEKVTCGPGHGISVGSLGKYHNEEPVVGVTVKNCTLINTMNGIRVKTWPDSPASVATDLHFEDIIMNNVG NPILINQEYCPYDQCQAKVPSQVKISDVSFQGICSMSGTQVAVVCSRGVPCQTVDISDINLT |
Full Sequence |
---|
Protein Sequence Length: 164 Download |
MGRSTGVNIS DAIIKTGDDS LSIGDGSQHI NVEKVTCGPG HGISVGSLGK YHNEEPVVGV 60 TVKNCTLINT MNGIRVKTWP DSPASVATDL HFEDIIMNNV GNPILINQEY CPYDQCQAKV 120 PSQVKISDVS FQGICSMSGT QVAVVCSRGV PCQTVDISDI NLT* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
PLN02218 | PLN02218 | 5.0e-34 | 7 | 162 | 158 | + polygalacturonase ADPG | ||
PLN02155 | PLN02155 | 2.0e-37 | 4 | 163 | 162 | + polygalacturonase | ||
PLN02793 | PLN02793 | 3.0e-38 | 4 | 162 | 161 | + Probable polygalacturonase | ||
pfam00295 | Glyco_hydro_28 | 1.0e-56 | 1 | 163 | 165 | + Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes is important in cell wall metabolism. | ||
PLN02188 | PLN02188 | 4.0e-64 | 3 | 162 | 163 | + polygalacturonase/glycoside hydrolase family protein |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004650 | polygalacturonase activity |
GO:0005975 | carbohydrate metabolic process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
EMBL | CAN65674.1 | 0 | 1 | 120 | 789 | 908 | hypothetical protein [Vitis vinifera] |
EMBL | CAN65676.1 | 0 | 1 | 145 | 22 | 166 | hypothetical protein [Vitis vinifera] |
EMBL | CAN65676.1 | 0 | 1 | 162 | 391 | 554 | hypothetical protein [Vitis vinifera] |
EMBL | CBI28400.1 | 0 | 1 | 163 | 1 | 163 | unnamed protein product [Vitis vinifera] |
RefSeq | XP_002282563.1 | 0 | 1 | 162 | 202 | 365 | PREDICTED: hypothetical protein [Vitis vinifera] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2iq7_G | 0.0000000000002 | 1 | 163 | 159 | 320 | A Chain A, Crystal Structure Of The Polygalacturonase From Colletotrichum Lupini And Its Implications For The Interaction With Polygalacturonase- Inhibiting Proteins |
PDB | 2iq7_F | 0.0000000000002 | 1 | 163 | 159 | 320 | A Chain A, Crystal Structure Of The Polygalacturonase From Colletotrichum Lupini And Its Implications For The Interaction With Polygalacturonase- Inhibiting Proteins |
PDB | 2iq7_E | 0.0000000000002 | 1 | 163 | 159 | 320 | A Chain A, Crystal Structure Of The Polygalacturonase From Colletotrichum Lupini And Its Implications For The Interaction With Polygalacturonase- Inhibiting Proteins |
PDB | 2iq7_D | 0.0000000000002 | 1 | 163 | 159 | 320 | A Chain A, Crystal Structure Of The Polygalacturonase From Colletotrichum Lupini And Its Implications For The Interaction With Polygalacturonase- Inhibiting Proteins |
PDB | 2iq7_C | 0.0000000000002 | 1 | 163 | 159 | 320 | A Chain A, Crystal Structure Of The Polygalacturonase From Colletotrichum Lupini And Its Implications For The Interaction With Polygalacturonase- Inhibiting Proteins |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
CB969250 | 163 | 1 | 163 | 0 |
EC924927 | 163 | 1 | 163 | 0 |
EC935564 | 164 | 1 | 162 | 0 |
EC947475 | 164 | 1 | 162 | 0 |
EC939231 | 164 | 1 | 162 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|