| Basic Information | |
|---|---|
| Species | Vitis vinifera |
| Cazyme ID | GSVIVT01030031001 |
| Family | GH28 |
| Protein Properties | Length: 164 Molecular Weight: 17264.5 Isoelectric Point: 4.8093 |
| Chromosome | Chromosome/Scaffold: 12 Start: 9003706 End: 9004468 |
| Description | Pectin lyase-like superfamily protein |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| Plaza |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| GH28 | 2 | 163 | 0 |
| GRSTGVNISDAIIKTGDDSLSIGDGSQHINVEKVTCGPGHGISVGSLGKYHNEEPVVGVTVKNCTLINTMNGIRVKTWPDSPASVATDLHFEDIIMNNVG NPILINQEYCPYDQCQAKVPSQVKISDVSFQGICSMSGTQVAVVCSRGVPCQTVDISDINLT | |||
| Full Sequence |
|---|
| Protein Sequence Length: 164 Download |
| MGRSTGVNIS DAIIKTGDDS LSIGDGSQHI NVEKVTCGPG HGISVGSLGK YHNEEPVVGV 60 TVKNCTLINT MNGIRVKTWP DSPASVATDL HFEDIIMNNV GNPILINQEY CPYDQCQAKV 120 PSQVKISDVS FQGICSMSGT QVAVVCSRGV PCQTVDISDI NLT* 180 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN02218 | PLN02218 | 5.0e-34 | 7 | 162 | 158 | + polygalacturonase ADPG | ||
| PLN02155 | PLN02155 | 2.0e-37 | 4 | 163 | 162 | + polygalacturonase | ||
| PLN02793 | PLN02793 | 3.0e-38 | 4 | 162 | 161 | + Probable polygalacturonase | ||
| pfam00295 | Glyco_hydro_28 | 1.0e-56 | 1 | 163 | 165 | + Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes is important in cell wall metabolism. | ||
| PLN02188 | PLN02188 | 4.0e-64 | 3 | 162 | 163 | + polygalacturonase/glycoside hydrolase family protein | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004650 | polygalacturonase activity |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| EMBL | CAN65674.1 | 0 | 1 | 120 | 789 | 908 | hypothetical protein [Vitis vinifera] |
| EMBL | CAN65676.1 | 0 | 1 | 145 | 22 | 166 | hypothetical protein [Vitis vinifera] |
| EMBL | CAN65676.1 | 0 | 1 | 162 | 391 | 554 | hypothetical protein [Vitis vinifera] |
| EMBL | CBI28400.1 | 0 | 1 | 163 | 1 | 163 | unnamed protein product [Vitis vinifera] |
| RefSeq | XP_002282563.1 | 0 | 1 | 162 | 202 | 365 | PREDICTED: hypothetical protein [Vitis vinifera] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2iq7_G | 0.0000000000002 | 1 | 163 | 159 | 320 | A Chain A, Crystal Structure Of The Polygalacturonase From Colletotrichum Lupini And Its Implications For The Interaction With Polygalacturonase- Inhibiting Proteins |
| PDB | 2iq7_F | 0.0000000000002 | 1 | 163 | 159 | 320 | A Chain A, Crystal Structure Of The Polygalacturonase From Colletotrichum Lupini And Its Implications For The Interaction With Polygalacturonase- Inhibiting Proteins |
| PDB | 2iq7_E | 0.0000000000002 | 1 | 163 | 159 | 320 | A Chain A, Crystal Structure Of The Polygalacturonase From Colletotrichum Lupini And Its Implications For The Interaction With Polygalacturonase- Inhibiting Proteins |
| PDB | 2iq7_D | 0.0000000000002 | 1 | 163 | 159 | 320 | A Chain A, Crystal Structure Of The Polygalacturonase From Colletotrichum Lupini And Its Implications For The Interaction With Polygalacturonase- Inhibiting Proteins |
| PDB | 2iq7_C | 0.0000000000002 | 1 | 163 | 159 | 320 | A Chain A, Crystal Structure Of The Polygalacturonase From Colletotrichum Lupini And Its Implications For The Interaction With Polygalacturonase- Inhibiting Proteins |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
| Hit | Length | Start | End | EValue |
| CB969250 | 163 | 1 | 163 | 0 |
| EC924927 | 163 | 1 | 163 | 0 |
| EC935564 | 164 | 1 | 162 | 0 |
| EC947475 | 164 | 1 | 162 | 0 |
| EC939231 | 164 | 1 | 162 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
