| Basic Information | |
|---|---|
| Species | Vitis vinifera |
| Cazyme ID | GSVIVT01031323001 |
| Family | CE8 |
| Protein Properties | Length: 131 Molecular Weight: 14652.9 Isoelectric Point: 10.4511 |
| Chromosome | Chromosome/Scaffold: 14 Start: 371097 End: 371605 |
| Description | methylesterase PCR A |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| Plaza |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| CE8 | 26 | 113 | 2.4e-28 |
| FSTATYLGRPWKRYSRTVVMESTLGDLIHPKGWLARNGTFAVDTLLYAEYANKGPGADTSGRVDWKGYKVITNRTEALAYTVAPFIQG | |||
| Full Sequence |
|---|
| Protein Sequence Length: 131 Download |
| MVKKPLDNQQ NTITAIRGQE LFPVRFSTAT YLGRPWKRYS RTVVMESTLG DLIHPKGWLA 60 RNGTFAVDTL LYAEYANKGP GADTSGRVDW KGYKVITNRT EALAYTVAPF IQGDQWLKRS 120 GMPFLLGLKL * |
| Functional Domains Download unfiltered results here | ||||||
|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description |
| PLN02484 | PLN02484 | 4.0e-45 | 3 | 130 | 147 | + probable pectinesterase/pectinesterase inhibitor |
| PLN02713 | PLN02713 | 3.0e-45 | 3 | 128 | 145 | + Probable pectinesterase/pectinesterase inhibitor |
| PLN02301 | PLN02301 | 2.0e-48 | 3 | 128 | 145 | + pectinesterase/pectinesterase inhibitor |
| PLN02745 | PLN02745 | 3.0e-52 | 2 | 128 | 146 | + Putative pectinesterase/pectinesterase inhibitor |
| pfam01095 | Pectinesterase | 7.0e-58 | 1 | 114 | 133 | + Pectinesterase. |
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0005618 | cell wall |
| GO:0030599 | pectinesterase activity |
| GO:0042545 | cell wall modification |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| EMBL | CAN65743.1 | 0 | 6 | 130 | 290 | 411 | hypothetical protein [Vitis vinifera] |
| EMBL | CBI26012.1 | 0 | 1 | 129 | 421 | 568 | unnamed protein product [Vitis vinifera] |
| EMBL | CBI37070.1 | 1.4013e-45 | 1 | 129 | 113 | 260 | unnamed protein product [Vitis vinifera] |
| EMBL | CBI39666.1 | 0 | 1 | 130 | 1 | 130 | unnamed protein product [Vitis vinifera] |
| RefSeq | XP_002275000.1 | 0 | 1 | 129 | 421 | 568 | PREDICTED: hypothetical protein [Vitis vinifera] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 1gq8_A | 5e-38 | 7 | 128 | 192 | 319 | A Chain A, Pectin Methylesterase From Carrot |
| PDB | 1xg2_A | 1e-35 | 1 | 128 | 169 | 315 | B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein |
| Metabolic Pathways | |||
|---|---|---|---|
| Pathway Name | Reaction | EC | Protein Name |
| homogalacturonan degradation | RXN-2102 | EC-3.1.1.11 | pectinesterase |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
| Hit | Length | Start | End | EValue |
| CD013657 | 116 | 16 | 131 | 0 |
| CB008596 | 97 | 16 | 112 | 0 |
| EC946020 | 111 | 19 | 129 | 0 |
| EC944910 | 111 | 19 | 129 | 0 |
| CD013657 | 32 | 1 | 32 | 8.5 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |