| Basic Information | |
|---|---|
| Species | Vitis vinifera |
| Cazyme ID | GSVIVT01031580001 |
| Family | GT1 |
| Protein Properties | Length: 132 Molecular Weight: 14522.5 Isoelectric Point: 4.6266 |
| Chromosome | Chromosome/Scaffold: 5 Start: 18422990 End: 18423385 |
| Description | UDP-Glycosyltransferase superfamily protein |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| Plaza |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| GT1 | 5 | 109 | 3.7e-30 |
| WCSQVEVLSNPSLGCFVTHCGWNSTLESLASGVPVVAFPQWTDQSTNAKLAEDVWKTGVRVTVNQEGIVESDEIKRCLELVMGDGEEAKEMRRNAKKWKG LAREA | |||
| Full Sequence |
|---|
| Protein Sequence Length: 132 Download |
| MIVPWCSQVE VLSNPSLGCF VTHCGWNSTL ESLASGVPVV AFPQWTDQST NAKLAEDVWK 60 TGVRVTVNQE GIVESDEIKR CLELVMGDGE EAKEMRRNAK KWKGLAREAV MEGGSSDKNL 120 KNFMDEVIQG Y* 180 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN02210 | PLN02210 | 5.0e-34 | 1 | 127 | 128 | + UDP-glucosyl transferase | ||
| PLN02173 | PLN02173 | 6.0e-46 | 1 | 127 | 128 | + UDP-glucosyl transferase family protein | ||
| PLN02448 | PLN02448 | 1.0e-47 | 1 | 130 | 133 | + UDP-glycosyltransferase family protein | ||
| PLN02555 | PLN02555 | 2.0e-51 | 1 | 130 | 132 | + limonoid glucosyltransferase | ||
| PLN02152 | PLN02152 | 1.0e-56 | 1 | 127 | 127 | + indole-3-acetate beta-glucosyltransferase | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0008152 | metabolic process |
| GO:0016758 | transferase activity, transferring hexosyl groups |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| EMBL | CAN75179.1 | 0 | 1 | 131 | 367 | 497 | hypothetical protein [Vitis vinifera] |
| EMBL | CBI39387.1 | 0 | 1 | 131 | 1 | 131 | unnamed protein product [Vitis vinifera] |
| RefSeq | XP_002263301.1 | 0 | 1 | 131 | 334 | 464 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002267330.1 | 0 | 1 | 131 | 335 | 465 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002267525.1 | 0 | 1 | 131 | 335 | 465 | PREDICTED: hypothetical protein [Vitis vinifera] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2c9z_A | 4e-24 | 1 | 127 | 328 | 450 | A Chain A, Crystal Structure Of The Nasturtium Seedling Mutant Xyloglucanase Isoform Nxg1-Delta-Yniig |
| PDB | 2c1z_A | 4e-24 | 1 | 127 | 328 | 450 | A Chain A, Crystal Structure Of The Nasturtium Seedling Mutant Xyloglucanase Isoform Nxg1-Delta-Yniig |
| PDB | 2c1x_A | 4e-24 | 1 | 127 | 328 | 450 | A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification |
| PDB | 2vg8_A | 1e-23 | 2 | 120 | 342 | 460 | A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification |
| PDB | 2vch_A | 1e-23 | 2 | 120 | 342 | 460 | A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification |
| Metabolic Pathways | |||
|---|---|---|---|
| Pathway Name | Reaction | EC | Protein Name |
| pelargonidin conjugates biosynthesis | RXN-7828 | EC-2.4.1 | UDP-D-glucose:pelargonidin-3-O-β-D-glucoside 5-O-glucosyltransferase |
| salvianin biosynthesis | RXN-7828 | EC-2.4.1 | UDP-D-glucose:pelargonidin-3-O-β-D-glucoside 5-O-glucosyltransferase |
| shisonin biosynthesis | RXN-8169 | EC-2.4.1 | UDP-D-glucose:cyanidin-3-O-β-D-glucoside 5-O-glucosyltransferase |
| shisonin biosynthesis | RXN-8205 | EC-2.4.1 | UDP-D-glucose:cyanidin 3-(p-coumaroyl)-glucoside 5-O-glucosyltransferase |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
| Hit | Length | Start | End | EValue |
| CD003686 | 132 | 1 | 132 | 0 |
| EC935282 | 132 | 1 | 132 | 0 |
| CD718782 | 132 | 1 | 132 | 0 |
| CD718997 | 132 | 1 | 132 | 0 |
| EV231179 | 132 | 1 | 132 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
