Basic Information | |
---|---|
Species | Vitis vinifera |
Cazyme ID | GSVIVT01031580001 |
Family | GT1 |
Protein Properties | Length: 132 Molecular Weight: 14522.5 Isoelectric Point: 4.6266 |
Chromosome | Chromosome/Scaffold: 5 Start: 18422990 End: 18423385 |
Description | UDP-Glycosyltransferase superfamily protein |
View CDS |
External Links |
---|
NCBI Taxonomy |
Plaza |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GT1 | 5 | 109 | 3.7e-30 |
WCSQVEVLSNPSLGCFVTHCGWNSTLESLASGVPVVAFPQWTDQSTNAKLAEDVWKTGVRVTVNQEGIVESDEIKRCLELVMGDGEEAKEMRRNAKKWKG LAREA |
Full Sequence |
---|
Protein Sequence Length: 132 Download |
MIVPWCSQVE VLSNPSLGCF VTHCGWNSTL ESLASGVPVV AFPQWTDQST NAKLAEDVWK 60 TGVRVTVNQE GIVESDEIKR CLELVMGDGE EAKEMRRNAK KWKGLAREAV MEGGSSDKNL 120 KNFMDEVIQG Y* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
PLN02210 | PLN02210 | 5.0e-34 | 1 | 127 | 128 | + UDP-glucosyl transferase | ||
PLN02173 | PLN02173 | 6.0e-46 | 1 | 127 | 128 | + UDP-glucosyl transferase family protein | ||
PLN02448 | PLN02448 | 1.0e-47 | 1 | 130 | 133 | + UDP-glycosyltransferase family protein | ||
PLN02555 | PLN02555 | 2.0e-51 | 1 | 130 | 132 | + limonoid glucosyltransferase | ||
PLN02152 | PLN02152 | 1.0e-56 | 1 | 127 | 127 | + indole-3-acetate beta-glucosyltransferase |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0008152 | metabolic process |
GO:0016758 | transferase activity, transferring hexosyl groups |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
EMBL | CAN75179.1 | 0 | 1 | 131 | 367 | 497 | hypothetical protein [Vitis vinifera] |
EMBL | CBI39387.1 | 0 | 1 | 131 | 1 | 131 | unnamed protein product [Vitis vinifera] |
RefSeq | XP_002263301.1 | 0 | 1 | 131 | 334 | 464 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002267330.1 | 0 | 1 | 131 | 335 | 465 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002267525.1 | 0 | 1 | 131 | 335 | 465 | PREDICTED: hypothetical protein [Vitis vinifera] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2c9z_A | 4e-24 | 1 | 127 | 328 | 450 | A Chain A, Crystal Structure Of The Nasturtium Seedling Mutant Xyloglucanase Isoform Nxg1-Delta-Yniig |
PDB | 2c1z_A | 4e-24 | 1 | 127 | 328 | 450 | A Chain A, Crystal Structure Of The Nasturtium Seedling Mutant Xyloglucanase Isoform Nxg1-Delta-Yniig |
PDB | 2c1x_A | 4e-24 | 1 | 127 | 328 | 450 | A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification |
PDB | 2vg8_A | 1e-23 | 2 | 120 | 342 | 460 | A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification |
PDB | 2vch_A | 1e-23 | 2 | 120 | 342 | 460 | A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification |
Metabolic Pathways | |||
---|---|---|---|
Pathway Name | Reaction | EC | Protein Name |
pelargonidin conjugates biosynthesis | RXN-7828 | EC-2.4.1 | UDP-D-glucose:pelargonidin-3-O-β-D-glucoside 5-O-glucosyltransferase |
salvianin biosynthesis | RXN-7828 | EC-2.4.1 | UDP-D-glucose:pelargonidin-3-O-β-D-glucoside 5-O-glucosyltransferase |
shisonin biosynthesis | RXN-8169 | EC-2.4.1 | UDP-D-glucose:cyanidin-3-O-β-D-glucoside 5-O-glucosyltransferase |
shisonin biosynthesis | RXN-8205 | EC-2.4.1 | UDP-D-glucose:cyanidin 3-(p-coumaroyl)-glucoside 5-O-glucosyltransferase |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
CD003686 | 132 | 1 | 132 | 0 |
EC935282 | 132 | 1 | 132 | 0 |
CD718782 | 132 | 1 | 132 | 0 |
CD718997 | 132 | 1 | 132 | 0 |
EV231179 | 132 | 1 | 132 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|