| Basic Information | |
|---|---|
| Species | Vitis vinifera |
| Cazyme ID | GSVIVT01031593001 |
| Family | GH16 |
| Protein Properties | Length: 209 Molecular Weight: 24119.1 Isoelectric Point: 9.4353 |
| Chromosome | Chromosome/Scaffold: 5 Start: 18634353 End: 18636084 |
| Description | xyloglucan endotransglucosylase/hydrolase 16 |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| Plaza |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| GH16 | 8 | 133 | 3.7e-21 |
| GNSAGTVTAYYLSSQGPTHDEIDFEFLGNLSGDPYILHTNVFTQGKGNREQQFYLWFDPTRNFHTYSIAWSAQHIIFLVDNVPIRLFKNAESMGVPFPKN QPMRIYSSLWNADDWATRGGLVKTDW | |||
| Full Sequence |
|---|
| Protein Sequence Length: 209 Download |
| MQLKLVAGNS AGTVTAYYLS SQGPTHDEID FEFLGNLSGD PYILHTNVFT QGKGNREQQF 60 YLWFDPTRNF HTYSIAWSAQ HIIFLVDNVP IRLFKNAESM GVPFPKNQPM RIYSSLWNAD 120 DWATRGGLVK TDWSKAPFTA YYRNFRASTS TSTSTFSDSA FQTQELDAYS RRRLRWVQKN 180 FMIYNYCTDL KRFPQGVPPE CKHSRFNL* 240 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam06955 | XET_C | 1.0e-19 | 165 | 201 | 37 | + Xyloglucan endo-transglycosylase (XET) C-terminus. This family represents the C-terminus (approximately 60 residues) of plant xyloglucan endo-transglycosylase (XET). Xyloglucan is the predominant hemicellulose in the cell walls of most dicotyledons. With cellulose, it forms a network that strengthens the cell wall. XET catalyzes the splitting of xyloglucan chains and the linking of the newly generated reducing end to the non-reducing end of another xyloglucan chain, thereby loosening the cell wall. Note that all family members contain the pfam00722 domain. | ||
| cd02183 | GH16_fungal_CRH1_transglycosylase | 6.0e-26 | 4 | 146 | 158 | + glycosylphosphatidylinositol-glucanosyltransferase. Group of fungal GH16 members related to Saccharomyces cerevisiae Crh1p. Chr1p and Crh2p are transglycosylases that are required for the linkage of chitin to beta(1-3)glucose branches of beta(1-6)glucan, an important step in the assembly of new cell wall. Both have been shown to be glycosylphosphatidylinositol (GPI)-anchored. A third homologous protein, Crr1p, functions in the formation of the spore wall. They belongs to the family 16 of glycosyl hydrolases that includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues. | ||
| pfam00722 | Glyco_hydro_16 | 3.0e-61 | 1 | 135 | 137 | + Glycosyl hydrolases family 16. | ||
| PLN03161 | PLN03161 | 1.0e-89 | 1 | 206 | 218 | + Probable xyloglucan endotransglucosylase/hydrolase protein; Provisional | ||
| cd02176 | GH16_XET | 1.0e-121 | 1 | 201 | 212 | + Xyloglucan endotransglycosylase, member of glycosyl hydrolase family 16. Xyloglucan endotransglycosylases (XETs) cleave and religate xyloglucan polymers in plant cell walls via a transglycosylation mechanism. Xyloglucan is a soluble hemicellulose with a backbone of beta-1,4-linked glucose units, partially substituted with alpha-1,6-linked xylopyranose branches. It binds noncovalently to cellulose, cross-linking the adjacent cellulose microfibrils, giving it a key structural role as a matrix polymer. Therefore, XET plays an important role in all plant processes that require cell wall remodeling. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005618 | cell wall |
| GO:0005975 | carbohydrate metabolic process |
| GO:0006073 | cellular glucan metabolic process |
| GO:0016762 | xyloglucan:xyloglucosyl transferase activity |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| EMBL | CBI39399.1 | 0 | 1 | 208 | 1 | 208 | unnamed protein product [Vitis vinifera] |
| EMBL | CBI39403.1 | 0 | 1 | 208 | 1 | 208 | unnamed protein product [Vitis vinifera] |
| RefSeq | XP_002262761.1 | 0 | 1 | 208 | 74 | 281 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002266082.1 | 0 | 1 | 208 | 74 | 281 | PREDICTED: hypothetical protein isoform 1 [Vitis vinifera] |
| RefSeq | XP_002266121.1 | 0 | 1 | 208 | 79 | 286 | PREDICTED: hypothetical protein isoform 2 [Vitis vinifera] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 1un1_B | 0 | 1 | 205 | 64 | 276 | A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification |
| PDB | 1un1_A | 0 | 1 | 205 | 64 | 276 | A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification |
| PDB | 1umz_B | 0 | 1 | 205 | 64 | 276 | A Chain A, Xyloglucan Endotransglycosylase In Complex With The Xyloglucan Nonasaccharide Xllg. |
| PDB | 1umz_A | 0 | 1 | 205 | 64 | 276 | A Chain A, Xyloglucan Endotransglycosylase In Complex With The Xyloglucan Nonasaccharide Xllg. |
| PDB | 2uwb_B | 0 | 3 | 201 | 67 | 267 | A Chain A, Crystal Structure Of The Nasturtium Seedling Mutant Xyloglucanase Isoform Nxg1-Delta-Yniig |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
| Hit | Length | Start | End | EValue |
| EC976671 | 208 | 2 | 209 | 0 |
| EC930667 | 209 | 1 | 209 | 0 |
| EV241932 | 209 | 1 | 209 | 0 |
| EC980985 | 199 | 11 | 209 | 0 |
| EV241155 | 205 | 1 | 205 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
