| Basic Information | |
|---|---|
| Species | Vitis vinifera |
| Cazyme ID | GSVIVT01032009001 |
| Family | GH1 |
| Protein Properties | Length: 131 Molecular Weight: 15409.8 Isoelectric Point: 9.6514 |
| Chromosome | Chromosome/Scaffold: 13 Start: 23595417 End: 23596136 |
| Description | beta glucosidase 15 |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| Plaza |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| GH1 | 6 | 128 | 0 |
| GSSWLSVYPSGIQSLLLYVKRKYNNPLIYITENGITEVNNNTLTLKEALKDPQRIDYYYRHLLFLQLAIKDGVNVKSYFAWSLLDNYEWNFGYTVRFGIV FVDYDNGLKRYPKHSAIWFKKFL | |||
| Full Sequence |
|---|
| Protein Sequence Length: 131 Download |
| MYLPTGSSWL SVYPSGIQSL LLYVKRKYNN PLIYITENGI TEVNNNTLTL KEALKDPQRI 60 DYYYRHLLFL QLAIKDGVNV KSYFAWSLLD NYEWNFGYTV RFGIVFVDYD NGLKRYPKHS 120 AIWFKKFLLS * 180 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| TIGR01233 | lacG | 3.0e-24 | 3 | 125 | 133 | + 6-phospho-beta-galactosidase. This enzyme is part of the tagatose-6-phosphate pathway of galactose-6-phosphate degradation [Energy metabolism, Biosynthesis and degradation of polysaccharides]. | ||
| PRK13511 | PRK13511 | 1.0e-28 | 11 | 126 | 121 | + 6-phospho-beta-galactosidase; Provisional | ||
| COG2723 | BglB | 6.0e-32 | 2 | 126 | 127 | + Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism] | ||
| TIGR03356 | BGL | 6.0e-41 | 5 | 124 | 123 | + beta-galactosidase. | ||
| pfam00232 | Glyco_hydro_1 | 1.0e-42 | 4 | 127 | 124 | + Glycosyl hydrolase family 1. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| EMBL | CBI24822.1 | 0 | 1 | 130 | 1 | 130 | unnamed protein product [Vitis vinifera] |
| RefSeq | XP_002270016.1 | 0 | 6 | 130 | 260 | 384 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002277243.1 | 0 | 5 | 129 | 284 | 408 | PREDICTED: hypothetical protein isoform 2 [Vitis vinifera] |
| RefSeq | XP_002277408.1 | 0 | 5 | 129 | 381 | 505 | PREDICTED: hypothetical protein isoform 1 [Vitis vinifera] |
| RefSeq | XP_002277522.1 | 0 | 5 | 129 | 284 | 408 | PREDICTED: hypothetical protein isoform 3 [Vitis vinifera] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3ptq_B | 0 | 5 | 129 | 380 | 504 | A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12 |
| PDB | 3ptq_A | 0 | 5 | 129 | 380 | 504 | A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12 |
| PDB | 3ptm_B | 0 | 5 | 129 | 380 | 504 | A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12 |
| PDB | 3ptm_A | 0 | 5 | 129 | 380 | 504 | A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12 |
| PDB | 3ptk_B | 0 | 5 | 129 | 380 | 504 | A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12 |
| Metabolic Pathways | |||
|---|---|---|---|
| Pathway Name | Reaction | EC | Protein Name |
| coumarin biosynthesis (via 2-coumarate) | RXN-8036 | EC-3.2.1.21 | β-glucosidase |
| linamarin degradation | RXN-5341 | EC-3.2.1.21 | β-glucosidase |
| linustatin bioactivation | RXN-13602 | EC-3.2.1.21 | β-glucosidase |
| linustatin bioactivation | RXN-5341 | EC-3.2.1.21 | β-glucosidase |
| lotaustralin degradation | RXN-9674 | EC-3.2.1.21 | β-glucosidase |
| neolinustatin bioactivation | RXN-13603 | EC-3.2.1.21 | β-glucosidase |
| neolinustatin bioactivation | RXN-9674 | EC-3.2.1.21 | β-glucosidase |
| taxiphyllin bioactivation | RXN-13600 | EC-3.2.1.21 | β-glucosidase |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
| Hit | Length | Start | End | EValue |
| EC926150 | 125 | 5 | 129 | 0 |
| FN763872 | 125 | 4 | 128 | 0 |
| FF380558 | 124 | 5 | 128 | 0 |
| FY794700 | 124 | 5 | 128 | 0 |
| FS970810 | 127 | 4 | 130 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |