Basic Information | |
---|---|
Species | Vitis vinifera |
Cazyme ID | GSVIVT01032009001 |
Family | GH1 |
Protein Properties | Length: 131 Molecular Weight: 15409.8 Isoelectric Point: 9.6514 |
Chromosome | Chromosome/Scaffold: 13 Start: 23595417 End: 23596136 |
Description | beta glucosidase 15 |
View CDS |
External Links |
---|
NCBI Taxonomy |
Plaza |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH1 | 6 | 128 | 0 |
GSSWLSVYPSGIQSLLLYVKRKYNNPLIYITENGITEVNNNTLTLKEALKDPQRIDYYYRHLLFLQLAIKDGVNVKSYFAWSLLDNYEWNFGYTVRFGIV FVDYDNGLKRYPKHSAIWFKKFL |
Full Sequence |
---|
Protein Sequence Length: 131 Download |
MYLPTGSSWL SVYPSGIQSL LLYVKRKYNN PLIYITENGI TEVNNNTLTL KEALKDPQRI 60 DYYYRHLLFL QLAIKDGVNV KSYFAWSLLD NYEWNFGYTV RFGIVFVDYD NGLKRYPKHS 120 AIWFKKFLLS * |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
TIGR01233 | lacG | 3.0e-24 | 3 | 125 | 133 | + 6-phospho-beta-galactosidase. This enzyme is part of the tagatose-6-phosphate pathway of galactose-6-phosphate degradation [Energy metabolism, Biosynthesis and degradation of polysaccharides]. | ||
PRK13511 | PRK13511 | 1.0e-28 | 11 | 126 | 121 | + 6-phospho-beta-galactosidase; Provisional | ||
COG2723 | BglB | 6.0e-32 | 2 | 126 | 127 | + Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism] | ||
TIGR03356 | BGL | 6.0e-41 | 5 | 124 | 123 | + beta-galactosidase. | ||
pfam00232 | Glyco_hydro_1 | 1.0e-42 | 4 | 127 | 124 | + Glycosyl hydrolase family 1. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
GO:0005975 | carbohydrate metabolic process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
EMBL | CBI24822.1 | 0 | 1 | 130 | 1 | 130 | unnamed protein product [Vitis vinifera] |
RefSeq | XP_002270016.1 | 0 | 6 | 130 | 260 | 384 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002277243.1 | 0 | 5 | 129 | 284 | 408 | PREDICTED: hypothetical protein isoform 2 [Vitis vinifera] |
RefSeq | XP_002277408.1 | 0 | 5 | 129 | 381 | 505 | PREDICTED: hypothetical protein isoform 1 [Vitis vinifera] |
RefSeq | XP_002277522.1 | 0 | 5 | 129 | 284 | 408 | PREDICTED: hypothetical protein isoform 3 [Vitis vinifera] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3ptq_B | 0 | 5 | 129 | 380 | 504 | A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12 |
PDB | 3ptq_A | 0 | 5 | 129 | 380 | 504 | A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12 |
PDB | 3ptm_B | 0 | 5 | 129 | 380 | 504 | A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12 |
PDB | 3ptm_A | 0 | 5 | 129 | 380 | 504 | A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12 |
PDB | 3ptk_B | 0 | 5 | 129 | 380 | 504 | A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12 |
Metabolic Pathways | |||
---|---|---|---|
Pathway Name | Reaction | EC | Protein Name |
coumarin biosynthesis (via 2-coumarate) | RXN-8036 | EC-3.2.1.21 | β-glucosidase |
linamarin degradation | RXN-5341 | EC-3.2.1.21 | β-glucosidase |
linustatin bioactivation | RXN-13602 | EC-3.2.1.21 | β-glucosidase |
linustatin bioactivation | RXN-5341 | EC-3.2.1.21 | β-glucosidase |
lotaustralin degradation | RXN-9674 | EC-3.2.1.21 | β-glucosidase |
neolinustatin bioactivation | RXN-13603 | EC-3.2.1.21 | β-glucosidase |
neolinustatin bioactivation | RXN-9674 | EC-3.2.1.21 | β-glucosidase |
taxiphyllin bioactivation | RXN-13600 | EC-3.2.1.21 | β-glucosidase |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
EC926150 | 125 | 5 | 129 | 0 |
FN763872 | 125 | 4 | 128 | 0 |
FF380558 | 124 | 5 | 128 | 0 |
FY794700 | 124 | 5 | 128 | 0 |
FS970810 | 127 | 4 | 130 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|