| Basic Information | |
|---|---|
| Species | Vitis vinifera |
| Cazyme ID | GSVIVT01032022001 |
| Family | GH1 |
| Protein Properties | Length: 152 Molecular Weight: 17261.8 Isoelectric Point: 9.029 |
| Chromosome | Chromosome/Scaffold: 13 Start: 23466091 End: 23467704 |
| Description | beta glucosidase 12 |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| Plaza |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| GH1 | 12 | 144 | 1.49939e-42 |
| PHIIDDFRDFAELCFKEFGDRVKYWITLNEPWTYSNGGYDQGTLAPGRCSNWVNGACTAGNSAIEPYLVGHHLLLSHAAAVKVYKDKYQATQKGKIGITL VSNRMVPYSDQKADKKAVTRALDFMLGWFMNPL | |||
| Full Sequence |
|---|
| Protein Sequence Length: 152 Download |
| MNYYQKVYNP TPHIIDDFRD FAELCFKEFG DRVKYWITLN EPWTYSNGGY DQGTLAPGRC 60 SNWVNGACTA GNSAIEPYLV GHHLLLSHAA AVKVYKDKYQ ATQKGKIGIT LVSNRMVPYS 120 DQKADKKAVT RALDFMLGWF MNPLNLWRLS I* 180 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| COG2723 | BglB | 3.0e-28 | 13 | 146 | 134 | + Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism] | ||
| PLN02998 | PLN02998 | 1.0e-34 | 14 | 144 | 131 | + beta-glucosidase | ||
| PLN02814 | PLN02814 | 1.0e-39 | 14 | 144 | 131 | + beta-glucosidase | ||
| pfam00232 | Glyco_hydro_1 | 1.0e-39 | 14 | 144 | 132 | + Glycosyl hydrolase family 1. | ||
| PLN02849 | PLN02849 | 1.0e-41 | 14 | 144 | 131 | + beta-glucosidase | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| EMBL | CAN71219.1 | 0 | 11 | 144 | 47 | 180 | hypothetical protein [Vitis vinifera] |
| EMBL | CBI24834.1 | 0 | 1 | 151 | 1 | 151 | unnamed protein product [Vitis vinifera] |
| RefSeq | XP_002276051.1 | 0 | 11 | 144 | 72 | 205 | PREDICTED: hypothetical protein isoform 1 [Vitis vinifera] |
| RefSeq | XP_002277408.1 | 0 | 11 | 144 | 169 | 302 | PREDICTED: hypothetical protein isoform 1 [Vitis vinifera] |
| RefSeq | XP_002277522.1 | 0 | 11 | 144 | 72 | 205 | PREDICTED: hypothetical protein isoform 3 [Vitis vinifera] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3ptq_B | 0 | 11 | 144 | 168 | 301 | A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase |
| PDB | 3ptq_A | 0 | 11 | 144 | 168 | 301 | A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase |
| PDB | 3ptm_B | 0 | 11 | 144 | 168 | 301 | A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase |
| PDB | 3ptm_A | 0 | 11 | 144 | 168 | 301 | A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase |
| PDB | 3ptk_B | 0 | 11 | 144 | 168 | 301 | A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12 |
| Metabolic Pathways | |||
|---|---|---|---|
| Pathway Name | Reaction | EC | Protein Name |
| tea aroma glycosidic precursor bioactivation | RXN-13691 | EC-3.2.1.149 | β-primeverosidase |
| tea aroma glycosidic precursor bioactivation | RXN-13692 | EC-3.2.1.149 | β-primeverosidase |
| tea aroma glycosidic precursor bioactivation | RXN-13693 | EC-3.2.1.149 | β-primeverosidase |
| tea aroma glycosidic precursor bioactivation | RXN-13694 | EC-3.2.1.149 | β-primeverosidase |
| tea aroma glycosidic precursor bioactivation | RXN-13695 | EC-3.2.1.149 | β-primeverosidase |
| tea aroma glycosidic precursor bioactivation | RXN-13696 | EC-3.2.1.149 | β-primeverosidase |
| tea aroma glycosidic precursor bioactivation | RXN-13701 | EC-3.2.1.149 | β-primeverosidase |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
| Hit | Length | Start | End | EValue |
| CV096451 | 142 | 11 | 152 | 0 |
| CX295719 | 134 | 11 | 144 | 0 |
| FC065859 | 108 | 33 | 140 | 0 |
| FN763364 | 134 | 11 | 144 | 0 |
| EY841862 | 134 | 11 | 144 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |