CAZyme Information

Basic Information
SpeciesVitis vinifera
Cazyme IDGSVIVT01032989001
FamilyGH38
Protein PropertiesLength: 1026 Molecular Weight: 115410 Isoelectric Point: 5.7914
ChromosomeChromosome/Scaffold: 14 Start: 24903072 End: 24918092
DescriptionGlycosyl hydrolase family 38 protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH38363480
  NVHLVAHTHDDVGWLKTVDQYYVGSNNSIQGACVENVLDSMVTALLADKNRKFIYVEQAFFQRWWRDQSETVQGIVKQLVRSGQLEFINGGMCMHDEAAT
  HYIDMVDQTTLGHRFLKKEFGVTPRIGWQIDPFGHSAVQAYLLGAEVGFDALYFGRIDYQDRDKRKGEKSLEVVWRASRNFDASAQIFAGAFPENYEPPP
  GGFYFEVNDDSPIVQDDINLFDYNVQDRVNDFVAAAVSQANITRTNHIMWTMGTDFKYQYAHTWFRQMDKLIHYVNKDGRVNALYSTPSIYTDAKFATNE
  SWPIKTDDFFPYA
Full Sequence
Protein Sequence     Length: 1026     Download
MEISLFFVLL LAGIFHAESK FMVYDTSPRL VPGKINVHLV AHTHDDVGWL KTVDQYYVGS    60
NNSIQGACVE NVLDSMVTAL LADKNRKFIY VEQAFFQRWW RDQSETVQGI VKQLVRSGQL    120
EFINGGMCMH DEAATHYIDM VDQTTLGHRF LKKEFGVTPR IGWQIDPFGH SAVQAYLLGA    180
EVGFDALYFG RIDYQDRDKR KGEKSLEVVW RASRNFDASA QIFAGAFPEN YEPPPGGFYF    240
EVNDDSPIVQ DDINLFDYNV QDRVNDFVAA AVSQANITRT NHIMWTMGTD FKYQYAHTWF    300
RQMDKLIHYV NKDGRVNALY STPSIYTDAK FATNESWPIK TDDFFPYADS ANAYWTGYFT    360
SRPAIKRYVR MMSGYYLAAR QLEFFKGRSD SGPTTDALAD ALAIAQHHDA VTGTEKQHVA    420
SDYAKRLSMG YDKAEELVAA SLACLAESMP SAGCGNPTTK FQQCALLNIS YCPPSEIDLS    480
HGKKLIVVVY NSLGWKRDDV IRIPVINEDV TVHDSNGKMI ESQILPLVNA HVGMRNYYVK    540
AYLGKTPSEA PKYWLAFSAS VPPLGFSTYT ISRAERTAST LTTSSVFTPR AMETSTVEVG    600
QGNLRLTFSA DVGKMTHYTN SRSLVKEPVQ LSYSFYTGND GSDKDPQASG AYIFRPNRTF    660
VIKPEEESPL TVMRGPLLDE VHQRINPWIY QVTRLYKGKE HAEVEFAVGP IPIDDGIGKE    720
VATQITTTMA TNKTFYTDSN GRDFIKRIRD YRTDWDLKVN QPVAGNYYPI NLGIYIQDDK    780
TELSVLVDRS VGGSSIADGQ IELMLHRRLL HDDSKGVAEA LNETVCIHDK CTGLTIQGKF    840
YFRIDPLGEG AKWRRSAGQE IYSPFLLAFT EEDGDNWMSS HVPTFSGIDP SYSLPDNVAL    900
ITLQELDDGK VLLRLAHLFE IGEDKDLSVM SSVELKKLFP GKKISKVTEM SLSANQEREE    960
MEQKRLVWKV EGSPEKEPEL ARGRPVNPTN LVVELAPMEI RTFVIEIGSL PLRKSQMPED    1020
GRYAA* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd10809GH38N_AMII_GMII_SfManIII_like4.0e-7234359355+
pfam01074Glyco_hydro_381.0e-9336348317+
PLN02701PLN027011.0e-9534819875+
cd00451GH38N_AMII_euk4.0e-10335312278+
cd10810GH38N_AMII_LAM_like8.0e-17935312280+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0004559alpha-mannosidase activity
GO:0005975carbohydrate metabolic process
GO:0006013mannose metabolic process
GO:0008270zinc ion binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI21276.101102511025unnamed protein product [Vitis vinifera]
RefSeqXP_002276092.101102511025PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002280858.10171005211006PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002318770.103100541009predicted protein [Populus trichocarpa]
RefSeqXP_002321075.1020100724999predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1o7d_A0243183298C Chain C, The Structure Of The Bovine Lysosomal A-Mannosidase Suggests A Novel Mechanism For Low Ph Activation
PDB3eju_A03482180882C Chain C, The Structure Of The Bovine Lysosomal A-Mannosidase Suggests A Novel Mechanism For Low Ph Activation
PDB3ejt_A03482180882C Chain C, The Structure Of The Bovine Lysosomal A-Mannosidase Suggests A Novel Mechanism For Low Ph Activation
PDB3ejs_A03482180882C Chain C, The Structure Of The Bovine Lysosomal A-Mannosidase Suggests A Novel Mechanism For Low Ph Activation
PDB3ejr_A03482180882C Chain C, The Structure Of The Bovine Lysosomal A-Mannosidase Suggests A Novel Mechanism For Low Ph Activation
Signal Peptide
Cleavage Site
19
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7800626033299290
FG2273944941846760
ES8123443076219270
HO780062882443317.00649e-43
HO780062214114311.4
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_00345.1.265.483Aquca_002_00345.1.265.483Aquca_006_00230.1Aquca_006_00257.5Aquca_006_00257.9
Aquca_006_00257.8Aquca_006_00257.7Aquca_006_00257.6Aquca_006_00257.4Aquca_006_00257.3
Aquca_006_00257.2Aquca_006_00257.1Aquca_043_00016.7Aquca_043_00016.8Aquca_043_00016.6
Aquca_043_00016.5Aquca_043_00016.4Aquca_043_00016.3Aquca_043_00016.2Aquca_043_00016.1
Aquca_043_00019.2Aquca_043_00019.1Aquca_043_00018.1Aquca_056_00071.1Aquca_002_00345.1.162.261
Aquca_002_00345.1.162.261
Arabidopsis lyrata488339488225497001484445
Arabidopsis thalianaAT5G14950.1AT5G66150.1AT5G13980.3AT5G13980.2AT5G13980.1
AT3G26720.2AT3G26720.1
Brachypodium distachyonBradi1g44550.1Bradi3g21117.1Bradi4g17327.1Bradi4g17317.1
Brassica rapaBra023496Bra006275Bra037183Bra006227Bra025225
Carica papayaevm.model.supercontig_6.275evm.model.supercontig_70.70evm.model.supercontig_2646.1evm.TU.contig_36966.1evm.model.supercontig_70.69
Capsella rubellaCarubv10000075mCarubv10002909mCarubv10027738mCarubv10016625m
Citrus clementinaCiclev10014083mCiclev10017635mCiclev10024829mCiclev10024800mCiclev10030627m
Ciclev10014156mCiclev10014160mCiclev10014123m
Citrus sinensisorange1.1g002547morange1.1g002518morange1.1g002134morange1.1g001061morange1.1g015028m
orange1.1g002366morange1.1g004057morange1.1g001910morange1.1g001850morange1.1g002764m
orange1.1g002170morange1.1g002162morange1.1g002383morange1.1g001963morange1.1g001813m
orange1.1g002938morange1.1g002542morange1.1g002064morange1.1g002056morange1.1g002046m
orange1.1g002036m
Cucumis sativusCucsa.339310.1Cucsa.043720.1Cucsa.188400.2Cucsa.188400.1
Eucalyptus grandisEucgr.J02166.1Eucgr.L01536.1Eucgr.J02456.1Eucgr.K02195.1Eucgr.J02455.3
Eucgr.J02455.2Eucgr.J02455.1Eucgr.I01600.1Eucgr.G01931.1Eucgr.J02460.1
Eucgr.J02454.1Eucgr.L01537.1Eucgr.J02457.1Eucgr.J02459.2Eucgr.J02459.1
Fragaria vescamrna28330.1-v1.0-hybridmrna14585.1-v1.0-hybridmrna01394.1-v1.0-hybrid.37.348mrna01394.1-v1.0-hybrid.37.348mrna06416.1-v1.0-hybrid.39.351
mrna06416.1-v1.0-hybrid.39.351mrna14589.1-v1.0-hybrid.71.344
Glycine maxGlyma13g04761.3Glyma13g04761.2Glyma19g01890.1Glyma13g04761.1Glyma02g05240.2
Glyma02g05240.1Glyma16g23600.1Glyma01g36980.1Glyma06g17270.1Glyma04g37790.1
Glyma19g27660.2Glyma19g27660.1Glyma16g05240.2Glyma16g05240.1
Gossypium raimondiiGorai.001G258600.2Gorai.001G258600.1Gorai.006G027500.1Gorai.003G008600.2Gorai.003G008600.1
Gorai.006G000300.3Gorai.006G000300.2Gorai.006G000300.1Gorai.012G082700.6Gorai.012G082700.9
Gorai.012G082700.8Gorai.012G082700.7Gorai.012G082700.5Gorai.012G082700.4Gorai.012G082700.3
Gorai.012G082700.2Gorai.012G082700.10Gorai.012G082700.1Gorai.003G116600.2Gorai.003G116600.1
Linum usitatissimumLus10014507Lus10015337.248.571Lus10015337.248.571Lus10032179Lus10039457
Lus10012578Lus10035111Lus10012577Lus10036074Lus10025960
Lus10014259Lus10041516Lus10015337.158.248Lus10015337.158.248
Malus domesticaMDP0000888429MDP0000267909MDP0000250936MDP0000139458MDP0000274501
MDP0000274500MDP0000409920MDP0000163211MDP0000657082MDP0000211018
Manihot esculentacassava4.1_000571mcassava4.1_001602mcassava4.1_000993mcassava4.1_000971mcassava4.1_000869m
cassava4.1_001123mcassava4.1_001106m
Medicago truncatulaMedtr4g071680.1Medtr6g008850.1Medtr8g075330.1Medtr7g084040.1Medtr3g098650.2
Medtr3g098650.1Medtr7g084030.1
Mimulus guttatusmgv1a000435mmgv1a000658mmgv1a000852mmgv1a000690m
Oryza sativaLOC_Os06g13650.2LOC_Os06g13650.1LOC_Os06g13650.3LOC_Os11g32260.2LOC_Os11g32260.1
LOC_Os10g05069.2LOC_Os10g05069.1LOC_Os10g05069.3
Panicum virgatumPavirv00027286mPavirv00014532mPavirv00024149mPavirv00025946mPavirv00065120m
Physcomitrella patensPp1s10_34V6.1Pp1s77_136V6.1Pp1s129_147V6.1
Phaseolus vulgarisPhvul.004G022500.1Phvul.003G264400.1Phvul.001G084400.1Phvul.002G107300.1Phvul.001G084700.1
Phvul.009G161600.1
Picea abiesMA_10434251g0010MA_879613g0010MA_4107059g0010
Populus trichocarpaPotri.017G073900.2Potri.017G073900.1Potri.001G350400.2Potri.001G350400.1Potri.014G143600.1
Potri.014G143600.2Potri.007G056300.1Potri.002G238200.2Potri.002G238200.1Potri.012G106500.2
Potri.012G106500.1
Prunus persicappa000458mppa021513mppa000707mppa000755mppa000717m
Ricinus communis29822.m00342029868.m00034130131.m00698230131.m00698130147.m014412
Setaria italicaSi005719mSi038673mSi025964mSi034056mSi025881m
Selaginella moellendorffii104910154366266756410022178241
Sorghum bicolorSb10g008770.1Sb01g026405.1Sb05g019600.1Sb01g026390.1
Thellungiella halophilaThhalv10012487mThhalv10012612mThhalv10012546mThhalv10003575mThhalv10003577m
Vitis viniferaGSVIVT01032586001GSVIVT01018752001GSVIVT01032988001GSVIVT01008340001GSVIVT01008642001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)