CAZyme Information

Basic Information
SpeciesVitis vinifera
Cazyme IDGSVIVT01033349001
FamilyGH28
Protein PropertiesLength: 350 Molecular Weight: 39251.4 Isoelectric Point: 7.3145
ChromosomeChromosome/Scaffold: 8 Start: 21311999 End: 21315741
DescriptionPectin lyase-like superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH28202530
  TGACLGDECRPRLVGFLGCRNVRVWNIRLNEPAYWCLHLVGCNNTSIHDVSIYGDFNTPNNDGIDIEDSNNTVITRCSISTGDDSICPKTSNGPLYNLTV
  TNCWLRSRSSAIKLGSGSFYDFKGLVFDNITIDDSHRGLGMQIRDGGDVSDVTFSNMNIKTRYYEPVLWWGRAEPIYITTCPRDSNSKEGSISNIRFINI
  SATSENGVFLSGSKAGLLSNLRFQNVNFTYRRWT
Full Sequence
Protein Sequence     Length: 350     Download
MKFVKRFEEA KNVMVSWNET GACLGDECRP RLVGFLGCRN VRVWNIRLNE PAYWCLHLVG    60
CNNTSIHDVS IYGDFNTPNN DGIDIEDSNN TVITRCSIST GDDSICPKTS NGPLYNLTVT    120
NCWLRSRSSA IKLGSGSFYD FKGLVFDNIT IDDSHRGLGM QIRDGGDVSD VTFSNMNIKT    180
RYYEPVLWWG RAEPIYITTC PRDSNSKEGS ISNIRFINIS ATSENGVFLS GSKAGLLSNL    240
RFQNVNFTYR RWTNFPDDLV DYRPGCRGLV KHSPAGMIME HIDGLELENV NMRWSGVIQN    300
KRWNNPLDFL PSTVNNISFL NFQSGSDSNI MSLLNLKTFM TGKPLIAPS*               360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN03010PLN030101.0e-738225193+
PLN02188PLN021889.0e-1030250239+
PLN03003PLN030033.0e-1029175191+
pfam00295Glyco_hydro_287.0e-1330249235+
COG5434PGU11.0e-2617173171+
Gene Ontology
GO TermDescription
GO:0004650polygalacturonase activity
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI29894.1013491349unnamed protein product [Vitis vinifera]
RefSeqNP_567055.102325145469glycoside hydrolase family 28 protein / polygalacturonase (pectinase) family protein [Arabidopsis thaliana]
RefSeqXP_002282920.101328141468PREDICTED: hypothetical protein isoform 1 [Vitis vinifera]
RefSeqXP_002282925.101328141463PREDICTED: hypothetical protein isoform 2 [Vitis vinifera]
RefSeqXP_002322693.101325118440predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3jur_D0.000000000024250164391A Chain A, The Crystal Structure Of A Hyperthermoactive Exopolygalacturonase From Thermotoga Maritima
PDB3jur_C0.000000000024250164391A Chain A, The Crystal Structure Of A Hyperthermoactive Exopolygalacturonase From Thermotoga Maritima
PDB3jur_B0.000000000024250164391A Chain A, The Crystal Structure Of A Hyperthermoactive Exopolygalacturonase From Thermotoga Maritima
PDB3jur_A0.000000000024250164391A Chain A, The Crystal Structure Of A Hyperthermoactive Exopolygalacturonase From Thermotoga Maritima
PDB1bhe_A0.00230248151362A Chain A, Polygalacturonase From Erwinia Carotovora Ssp. Carotovora
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GR997483265212850
CD00656020712070
JK51724426112610
DY98261527212720
CB678856270202890
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00836.1
Arabidopsis lyrata324272
Arabidopsis thalianaAT3G57790.1
Brachypodium distachyonBradi4g33660.1
Brassica rapaBra035299
Carica papayaevm.TU.contig_34124.1
Capsella rubellaCarubv10019007m
Chlamydomonas reinhardtiiCre12.g556350.t1.3
Citrus clementinaCiclev10005155mCiclev10004869m
Citrus sinensisorange1.1g038762m
Cucumis sativusCucsa.242950.1
Eucalyptus grandisEucgr.K01816.4Eucgr.K01816.1Eucgr.K01816.3Eucgr.K01816.2
Fragaria vescamrna00558.1-v1.0-hybrid
Glycine maxGlyma19g32550.1
Gossypium raimondiiGorai.006G139700.1
Linum usitatissimumLus10026318Lus10042350
Malus domesticaMDP0000248311
Manihot esculentacassava4.1_024146m
Medicago truncatulaMedtr7g092470.1
Mimulus guttatusmgv1a005515m
Oryza sativaLOC_Os09g31270.1
Panicum virgatumPavirv00061210mPavirv00068607m
Physcomitrella patensPp1s116_9V6.1Pp1s375_23V6.1
Phaseolus vulgarisPhvul.001G138000.1
Populus trichocarpaPotri.016G051200.1
Prunus persicappa005960m
Ricinus communis27810.m000670
Setaria italicaSi029777m
Selaginella moellendorffii437695105243
Sorghum bicolorSb02g028280.1
Thellungiella halophilaThhalv10005936m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny