y PlantCAZyme

CAZyme Information

Basic Information
SpeciesVitis vinifera
Cazyme IDGSVIVT01034783001
FamilyAA1
Protein PropertiesLength: 568 Molecular Weight: 63437.8 Isoelectric Point: 6.143
ChromosomeChromosome/Scaffold: 18 Start: 21551208 End: 21566009
Descriptionlaccase 14
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA1155500
  INYYDFLLQDSNFTRLCSTKSMLTVNGSFPGPVLRAYRGDTVYVNVHNQGEYNITIHWHGVKQPRNPWADGPEYITQCPIQPGSNFTYEIIFSTEEGTLW
  WHAHSDWSRATIHGAIIVLPRKGTSYPFPEPDEEETIIFSSWFKGDVMKMYNEAVVTGVPKLSDAFTINGQPGDLYPCSNETTYRLLVQYGKTYLLRIVN
  AILNEELFFSVAEHNLTIVGTDGAYIKPVITNYIMIIPGQTLDVLVTANQPPSNYYMAARAFVSGTFSFHNGTTTGIFQYTNCCSLPLSILQYTSCCSPR
  LSPSFPNLPSYKDSAAALTFTKSLRSLANQDYPVYVPQNINTQIIMTVSLNLLPTPEASCARVVGNRCSGGLNNISWVMPSTAILQTYYRQMEQNIFTYD
  FPDQPPWSYNYTGENLPSSLLVASQGTKAKVVNYSETVEIVFQGTNAGGRAENHPMHLHGYNFYLVGIGSGNFNNETDPKNYNLNDPPYVNTIGVPKNGW
  AAIRFRAENPGVWFMHCHLEKHATWGMDMVLIVKNG
Full Sequence
Protein Sequence     Length: 568     Download
MLLNELLYCM AEGNINYYDF LLQDSNFTRL CSTKSMLTVN GSFPGPVLRA YRGDTVYVNV    60
HNQGEYNITI HWHGVKQPRN PWADGPEYIT QCPIQPGSNF TYEIIFSTEE GTLWWHAHSD    120
WSRATIHGAI IVLPRKGTSY PFPEPDEEET IIFSSWFKGD VMKMYNEAVV TGVPKLSDAF    180
TINGQPGDLY PCSNETTYRL LVQYGKTYLL RIVNAILNEE LFFSVAEHNL TIVGTDGAYI    240
KPVITNYIMI IPGQTLDVLV TANQPPSNYY MAARAFVSGT FSFHNGTTTG IFQYTNCCSL    300
PLSILQYTSC CSPRLSPSFP NLPSYKDSAA ALTFTKSLRS LANQDYPVYV PQNINTQIIM    360
TVSLNLLPTP EASCARVVGN RCSGGLNNIS WVMPSTAILQ TYYRQMEQNI FTYDFPDQPP    420
WSYNYTGENL PSSLLVASQG TKAKVVNYSE TVEIVFQGTN AGGRAENHPM HLHGYNFYLV    480
GIGSGNFNNE TDPKNYNLND PPYVNTIGVP KNGWAAIRFR AENPGVWFMH CHLEKHATWG    540
MDMVLIVKNG STAATSIRPP PAYMPDC*                                       600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR03390ascorbOXfungal2.0e-5226549560+
PLN02191PLN021914.0e-6531546548+
PLN02604PLN026042.0e-791544579+
TIGR03388ascorbase2.0e-8431544547+
TIGR03389laccase015567554+
Gene Ontology
GO TermDescription
GO:0005507copper ion binding
GO:0016491oxidoreductase activity
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI18270.1015671567unnamed protein product [Vitis vinifera]
EMBLCBI29312.10456768616unnamed protein product [Vitis vinifera]
RefSeqXP_002263602.10156718584PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002271222.10456719567PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002275352.10456721569PREDICTED: hypothetical protein [Vitis vinifera]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1asq_B0155453521A Chain A, Solution Structure Of The Insertion Region (510-573) Of Fthfs Domain From Mouse Methylenetetrahydrofolate Dehydrogenase (Nadp+ Dependent) 1-Like Prot
PDB1asq_A0155453521A Chain A, Solution Structure Of The Insertion Region (510-573) Of Fthfs Domain From Mouse Methylenetetrahydrofolate Dehydrogenase (Nadp+ Dependent) 1-Like Prot
PDB1asp_B0155453521A Chain A, Solution Structure Of The Insertion Region (510-573) Of Fthfs Domain From Mouse Methylenetetrahydrofolate Dehydrogenase (Nadp+ Dependent) 1-Like Prot
PDB1asp_A0155453521A Chain A, Solution Structure Of The Insertion Region (510-573) Of Fthfs Domain From Mouse Methylenetetrahydrofolate Dehydrogenase (Nadp+ Dependent) 1-Like Prot
PDB1aso_B0155453521A Chain A, Solution Structure Of The Insertion Region (510-573) Of Fthfs Domain From Mouse Methylenetetrahydrofolate Dehydrogenase (Nadp+ Dependent) 1-Like Prot
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO797675513605680
EC94775427562790
FC07098620682130
FQ44425425262560
EX659542242162560
Orthologous Group
SpeciesID
Arabidopsis lyrata917686487747
Arabidopsis thalianaAT5G48100.1AT5G09360.1
Brachypodium distachyonBradi3g59210.1Bradi3g59187.1
Brassica rapaBra020720Bra037510
Capsella rubellaCarubv10027828mCarubv10000589m
Citrus clementinaCiclev10003795m
Citrus sinensisorange1.1g036841m
Cucumis sativusCucsa.345760.1
Eucalyptus grandisEucgr.L01441.1Eucgr.J00889.1Eucgr.F02650.1Eucgr.H04936.1Eucgr.F04163.1
Eucgr.F02674.1Eucgr.H04937.1Eucgr.F02648.1Eucgr.F02642.1Eucgr.F02646.1
Eucgr.L00623.1Eucgr.B01273.1Eucgr.H02579.1Eucgr.F02649.1Eucgr.F04160.1
Eucgr.F04162.1Eucgr.F02641.1Eucgr.F04154.1Eucgr.L01656.1Eucgr.F02644.1
Eucgr.L00621.1Eucgr.C02745.1Eucgr.J00888.1Eucgr.F02652.2Eucgr.F02652.1
Eucgr.L01343.1Eucgr.L02310.1Eucgr.E04216.1Eucgr.G00841.1Eucgr.E04217.1
Eucgr.E04220.1Eucgr.E04219.1Eucgr.E04218.1Eucgr.E04221.1Eucgr.L01345.1
Eucgr.E03935.1Eucgr.F04158.1Eucgr.F02653.1Eucgr.E03932.1Eucgr.F04157.1
Eucgr.F02642.2Eucgr.F02649.2
Fragaria vescamrna16187.1-v1.0-hybridmrna27556.1-v1.0-hybridmrna27557.1-v1.0-hybridmrna27526.1-v1.0-hybridmrna27527.1-v1.0-hybrid
mrna27523.1-v1.0-hybridmrna15091.1-v1.0-hybridmrna27531.1-v1.0-hybridmrna24290.1-v1.0-hybridmrna27522.1-v1.0-hybrid
mrna17621.1-v1.0-hybridmrna11910.1-v1.0-hybridmrna24296.1-v1.0-hybridmrna05430.1-v1.0-hybridmrna24295.1-v1.0-hybrid
mrna02152.1-v1.0-hybridmrna24292.1-v1.0-hybridmrna08067.1-v1.0-hybridmrna11940.1-v1.0-hybrid
Glycine maxGlyma11g36058.1Glyma16g27480.1Glyma10g36320.1Glyma20g31280.1Glyma10g36310.1
Glyma20g31270.1
Gossypium raimondiiGorai.009G260400.1Gorai.009G260400.2Gorai.005G076600.2Gorai.005G076600.1Gorai.005G076600.3
Gorai.009G260600.1Gorai.009G261300.1Gorai.009G261000.1Gorai.009G260800.1Gorai.010G130100.1
Gorai.009G260400.3Gorai.009G261100.1Gorai.009G261500.1
Linum usitatissimumLus10041067Lus10026812Lus10036070Lus10041066
Malus domesticaMDP0000546342MDP0000143780MDP0000168293MDP0000318606MDP0000262848
MDP0000090732MDP0000242301MDP0000252988MDP0000724206MDP0000419919
MDP0000188477MDP0000263468MDP0000148967
Manihot esculentacassava4.1_028126mcassava4.1_005540mcassava4.1_026478mcassava4.1_027769m
Medicago truncatulaMedtr3g101640.1.30.558Medtr3g101640.1.30.558Medtr2g008330.1
Mimulus guttatusmgv1a018195mmgv1a019066mmgv1a021399mmgv1a003690mmgv1a004060m
Oryza sativaLOC_Os02g51440.1LOC_Os11g47390.1
Panicum virgatumPavirv00068445mPavirv00039877mPavirv00029470mPavirv00044315mPavirv00029948m
Phaseolus vulgarisPhvul.004G086400.1Phvul.007G086400.1Phvul.007G086500.1Phvul.004G087000.1
Populus trichocarpaPotri.005G200600.1Potri.005G200500.1Potri.011G071100.1Potri.019G088900.1Potri.019G088500.1
Potri.019G088600.1Potri.019G088800.1Potri.019G088700.1Potri.019G088700.2Potri.005G200700.1
Potri.001G206200.1Potri.005G200500.2Potri.005G200600.2
Prunus persicappa016123mppa003529mppa003546mppa016865mppa015996m
ppa025323mppa003489mppa014804mppa003580mppa003663m
ppa003583mppa025087m
Ricinus communis28644.m00090929703.m00152429703.m00152729703.m00153128660.m000189
29703.m00153028644.m00094028644.m00093728644.m000938
Setaria italicaSi016752mSi007952mSi019864mSi019724m
Sorghum bicolorSb04g027860.1Sb04g034620.1Sb04g034610.1Sb04g027850.1Sb10g030340.1
Sb05g022480.1
Thellungiella halophilaThhalv10003921mThhalv10015612m
Vitis viniferaGSVIVT01001603001GSVIVT01012329001GSVIVT01013689001GSVIVT01013695001GSVIVT01013694001
GSVIVT01012332001GSVIVT01012343001GSVIVT01034842001GSVIVT01034817001GSVIVT01001604001
GSVIVT01001614001GSVIVT01012346001GSVIVT01013687001.321.754GSVIVT01013687001.321.754GSVIVT01012359001
GSVIVT01034828001GSVIVT01013692001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)