CAZyme Information

Basic Information
SpeciesVitis vinifera
Cazyme IDGSVIVT01035995001
FamilyGT28
Protein PropertiesLength: 387 Molecular Weight: 42756.8 Isoelectric Point: 9.0297
ChromosomeChromosome/Scaffold: 4 Start: 6948586 End: 6957422
Descriptionmonogalactosyl diacylglycerol synthase 1
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT282033612.9e-31
  VLLMGGGEGMGPIEATARALGNALYNEDLGESIGQVLVICGRNKKLADKLRSIPWKIPVQVKGFVTKMEECMGACDCIITKAGPGTIAEAMIRGLPIILN
  DYIAGQEVGNVPYVVENGCGKFSKSPKEIAKIVGEWFGPKAEELAVMSQNALKLARPDA
Full Sequence
Protein Sequence     Length: 387     Download
MSDTGGGHRA SAEAIKAAFN EEFGEEYQVF VTDLWSDHTP WPFNQLPRSY NFLVKHGPLW    60
KMTYYGTAPR LVHQSNFAAT TTFIAREVAK GLMKYQPDII ISVHPLMQHV PLRILRAKGL    120
LKKIVFTTVV TDLSTCHPTW FHKLVTRCYC PTTDVAKRAL KAGLQSSQIK VYGLPVRPSF    180
VKPVRPKDEL RKELGMDEDL PAVLLMGGGE GMGPIEATAR ALGNALYNED LGESIGQVLV    240
ICGRNKKLAD KLRSIPWKIP VQVKGFVTKM EECMGACDCI ITKAGPGTIA EAMIRGLPII    300
LNDYIAGQEV GNVPYVVENG CGKFSKSPKE IAKIVGEWFG PKAEELAVMS QNALKLARPD    360
AVFKIVHDLH ELVRQRSFVT QYSCTT* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG0707MurG3.0e-275366370+
PRK13608PRK136089.0e-3192377289+
PRK13609PRK136095.0e-405372374+
pfam06925MGDG_synth7.0e-778176169+
PLN02605PLN0260501376378+
Gene Ontology
GO TermDescription
GO:0005975carbohydrate metabolic process
GO:0009247glycolipid biosynthetic process
GO:0016758transferase activity, transferring hexosyl groups
GO:0030246carbohydrate binding
GO:0030259lipid glycosylation
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN84152.101386135520hypothetical protein [Vitis vinifera]
EMBLCBI21162.1013861386unnamed protein product [Vitis vinifera]
RefSeqXP_002283410.101386167552PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002309689.101386152537predicted protein [Populus trichocarpa]
RefSeqXP_002515397.1013841505331,2-diacylglycerol 3-beta-galactosyltransferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3s2u_A0.0007249374227356A Chain A, Crystal Structure Of The Pseudomonas Aeruginosa Murg:udp-glcnac Substrate Comp
Metabolic Pathways
Pathway NameReactionECProtein Name
glycolipid biosynthesis2.4.1.46-RXNEC-2.4.1.46monogalactosyldiacylglycerol synthase
traumatin and (Z)-3-hexen-1-yl acetate biosynthesisHYDROHEX-RXN-13(S)-hydroperoxyoctadeca-9,11-dienoate lyase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EX267973342243650
EX260172300203190
GT049228336403750
CV53054028612860
DT757059297893840
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_016_00340.4Aquca_016_00340.1Aquca_048_00001.3Aquca_048_00001.1Aquca_016_00340.2
Arabidopsis lyrata899522913288488950
Arabidopsis thalianaAT2G11810.1AT4G31780.2AT5G20410.1AT4G31780.1
Brachypodium distachyonBradi4g30600.1Bradi3g54387.1Bradi3g20020.1
Brassica rapaBra023984Bra011297Bra037199Bra020104
Carica papayaevm.model.supercontig_148.42evm.model.supercontig_277.14
Capsella rubellaCarubv10006327mCarubv10013637mCarubv10000862m
Chlamydomonas reinhardtiig14367.t1
Citrus clementinaCiclev10007936mCiclev10007956mCiclev10008213mCiclev10008083m
Citrus sinensisorange1.1g036427morange1.1g012492m
Cucumis sativusCucsa.162930.1Cucsa.132470.1
Eucalyptus grandisEucgr.C04035.1Eucgr.C00320.1Eucgr.C00495.1Eucgr.C04379.1Eucgr.C04035.2
Fragaria vescamrna14993.1-v1.0-hybridmrna31719.1-v1.0-hybridmrna30765.1-v1.0-hybrid
Glycine maxGlyma17g33780.1Glyma14g12120.1Glyma13g23150.1Glyma17g11720.1
Gossypium raimondiiGorai.010G119700.2Gorai.001G039100.1Gorai.010G119700.1Gorai.013G236200.1Gorai.009G014700.1
Gorai.009G014700.3
Linum usitatissimumLus10026895Lus10003418Lus10016359Lus10008048
Malus domesticaMDP0000135680MDP0000244574MDP0000214451MDP0000829982MDP0000305295
Manihot esculentacassava4.1_005396mcassava4.1_005397mcassava4.1_006812m
Medicago truncatulaMedtr4g115920.2Medtr4g115920.1
Mimulus guttatusmgv1a004593mmgv1a006191m
Oryza sativaLOC_Os09g25580.1LOC_Os02g55910.2LOC_Os02g55910.1LOC_Os08g20420.1LOC_Os08g20420.2
Panicum virgatumPavirv00042978mPavirv00044523mPavirv00010348mPavirv00051656mPavirv00029899m
Pavirv00008414mPavirv00051657m
Physcomitrella patensPp1s33_287V6.1Pp1s20_66V6.1
Phaseolus vulgarisPhvul.001G042600.1Phvul.003G171300.1
Picea abiesMA_5461g0010
Populus trichocarpaPotri.006G266500.1Potri.018G016600.1Potri.006G063300.3Potri.006G063300.2Potri.006G063300.1
Potri.018G123000.1Potri.006G266500.2
Prunus persicappa003927mppa006453m
Ricinus communis29848.m00450927394.m000347
Setaria italicaSi029462mSi016983mSi015030m
Selaginella moellendorffii271007
Sorghum bicolorSb02g025070.1Sb04g036240.1Sb07g027910.1
Thellungiella halophilaThhalv10024883mThhalv10022676mThhalv10013431m
Vitis viniferaGSVIVT01012838001
Volvox carteriVocar20009507m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)