| Basic Information | |
|---|---|
| Species | Vitis vinifera |
| Cazyme ID | GSVIVT01038754001 |
| Family | CE8 |
| Protein Properties | Length: 93 Molecular Weight: 9868.16 Isoelectric Point: 5.5192 |
| Chromosome | Chromosome/Scaffold: 12 Start: 485168 End: 490927 |
| Description | Pectin lyase-like superfamily protein |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| Plaza |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| CE8 | 4 | 88 | 1.3e-28 |
| SGTHYFNQCYIQGSIDFIFGGARSIYQGCIIESIATTLGAIAAHRMESPNDGIGFSFVNSTIIGIGKIYLGRAWGEYSTAVYSTT | |||
| Full Sequence |
|---|
| Protein Sequence Length: 93 Download |
| MDLSGTHYFN QCYIQGSIDF IFGGARSIYQ GCIIESIATT LGAIAAHRME SPNDGIGFSF 60 VNSTIIGIGK IYLGRAWGEY STAVYSTTGS LI* 120 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN02432 | PLN02432 | 6.0e-25 | 1 | 88 | 88 | + putative pectinesterase | ||
| PLN02304 | PLN02304 | 3.0e-28 | 2 | 88 | 95 | + probable pectinesterase | ||
| PLN02634 | PLN02634 | 1.0e-29 | 2 | 88 | 87 | + probable pectinesterase | ||
| PLN02682 | PLN02682 | 2.0e-30 | 2 | 88 | 87 | + pectinesterase family protein | ||
| PLN02671 | PLN02671 | 1.0e-49 | 1 | 86 | 86 | + pectinesterase | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0005618 | cell wall |
| GO:0030599 | pectinesterase activity |
| GO:0042545 | cell wall modification |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| EMBL | CAN70341.1 | 1e-35 | 1 | 84 | 91 | 187 | hypothetical protein [Vitis vinifera] |
| EMBL | CBI32965.1 | 0 | 1 | 92 | 1 | 92 | unnamed protein product [Vitis vinifera] |
| RefSeq | NP_200370.1 | 2e-28 | 1 | 87 | 224 | 310 | QRT1 (QUARTET 1); pectinesterase [Arabidopsis thaliana] |
| RefSeq | XP_002264297.1 | 0 | 1 | 88 | 203 | 290 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002298857.1 | 3e-29 | 1 | 86 | 162 | 247 | predicted protein [Populus trichocarpa] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 1gq8_A | 0.0000005 | 4 | 84 | 142 | 234 | A Chain A, Pectin Methylesterase From Carrot |
| PDB | 1xg2_A | 0.00003 | 4 | 92 | 138 | 240 | B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein |
| PDB | 3uw0_A | 0.007 | 8 | 82 | 191 | 274 | A Chain A, Pectin Methylesterase From Yersinia Enterocolitica |
| Metabolic Pathways | |||
|---|---|---|---|
| Pathway Name | Reaction | EC | Protein Name |
| homogalacturonan degradation | RXN-2102 | EC-3.1.1.11 | pectinesterase |
| Hydropathy |
|---|
 |