Basic Information | |
---|---|
Species | Glycine max |
Cazyme ID | Glyma02g47620.1 |
Family | CBM43 |
Protein Properties | Length: 119 Molecular Weight: 13127.9 Isoelectric Point: 5.5524 |
Chromosome | Chromosome/Scaffold: 02 Start: 51146926 End: 51149284 |
Description | Carbohydrate-binding X8 domain superfamily protein |
View CDS |
External Links |
---|
NCBI Taxonomy |
Plaza |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 30 | 113 | 9.9e-35 |
WCVADEQTTDSELQAALDWACGKGGADCSKIQVNQPCYLPNTLKGHASYAFNSYYQKFKHSGGSCYFRGASITTEVDPSYGSCH |
Full Sequence |
---|
Protein Sequence Length: 119 Download |
MATFMLKLVL PLLFLSMIPP KTAYAEFEQW CVADEQTTDS ELQAALDWAC GKGGADCSKI 60 QVNQPCYLPN TLKGHASYAF NSYYQKFKHS GGSCYFRGAS ITTEVDPSYG SCHYDFIP* 120 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 9.0e-20 | 29 | 99 | 76 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 5.0e-38 | 29 | 114 | 86 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
EMBL | CBI28425.1 | 0 | 25 | 118 | 24 | 117 | unnamed protein product [Vitis vinifera] |
RefSeq | NP_198423.1 | 0 | 1 | 118 | 1 | 119 | glycosyl hydrolase family protein 17 [Arabidopsis thaliana] |
RefSeq | XP_002307902.1 | 0 | 3 | 118 | 4 | 118 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002321180.1 | 0 | 1 | 118 | 1 | 117 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002531703.1 | 0 | 1 | 108 | 1 | 107 | hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 0.000000000000002 | 30 | 114 | 13 | 96 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |