| Basic Information | |
|---|---|
| Species | Glycine max |
| Cazyme ID | Glyma03g08040.1 |
| Family | GH9 |
| Protein Properties | Length: 151 Molecular Weight: 16698.2 Isoelectric Point: 8.4376 |
| Chromosome | Chromosome/Scaffold: 03 Start: 8879133 End: 8879731 |
| Description | glycosyl hydrolase 9B7 |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| Plaza |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH9 | 35 | 151 | 1.9e-29 |
| YCSALKTAMQFFDAFILFPLKYAGRLVDSKISWRGNSALKDGSQAKLDLSKGMYDARDNMKFGFPMAFMATVLSWSILEYGDQMDHVGQLDAAQDSLKWI TDFLINAHPSENVLYIQ | |||
| Full Sequence |
|---|
| Protein Sequence Length: 151 Download |
| PVAAIVFTVK KKFSHSGSDK PAPVLGPPGA VDQKYCSALK TAMQFFDAFI LFPLKYAGRL 60 VDSKISWRGN SALKDGSQAK LDLSKGMYDA RDNMKFGFPM AFMATVLSWS ILEYGDQMDH 120 VGQLDAAQDS LKWITDFLIN AHPSENVLYI Q |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN02613 | PLN02613 | 3.0e-30 | 29 | 151 | 124 | + endoglucanase | ||
| PLN02171 | PLN02171 | 1.0e-34 | 22 | 149 | 129 | + endoglucanase | ||
| PLN00119 | PLN00119 | 2.0e-35 | 29 | 151 | 124 | + endoglucanase | ||
| pfam00759 | Glyco_hydro_9 | 3.0e-37 | 35 | 151 | 118 | + Glycosyl hydrolase family 9. | ||
| PLN02345 | PLN02345 | 5.0e-64 | 38 | 151 | 114 | + endoglucanase | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| DDBJ | BAF42037.1 | 0 | 15 | 151 | 38 | 167 | cellulase2 [Pyrus communis] |
| RefSeq | XP_002276739.1 | 0 | 18 | 151 | 38 | 165 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002300715.1 | 0 | 18 | 151 | 38 | 166 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002307711.1 | 0 | 31 | 151 | 51 | 165 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002510516.1 | 0 | 11 | 151 | 33 | 165 | endo-1,4-beta-glucanase, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 4tf4_B | 4e-28 | 34 | 151 | 5 | 117 | B Chain B, Crystal Structure Of Plant Cell Wall Invertase In Complex With A Specific Protein Inhibitor |
| PDB | 4tf4_A | 4e-28 | 34 | 151 | 5 | 117 | B Chain B, Crystal Structure Of Plant Cell Wall Invertase In Complex With A Specific Protein Inhibitor |
| PDB | 3tf4_B | 4e-28 | 34 | 151 | 5 | 117 | B Chain B, Crystal Structure Of Plant Cell Wall Invertase In Complex With A Specific Protein Inhibitor |
| PDB | 3tf4_A | 4e-28 | 34 | 151 | 5 | 117 | B Chain B, Crystal Structure Of Plant Cell Wall Invertase In Complex With A Specific Protein Inhibitor |
| PDB | 1tf4_B | 4e-28 | 34 | 151 | 5 | 117 | B Chain B, Crystal Structure Of Plant Cell Wall Invertase In Complex With A Specific Protein Inhibitor |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| HO036869 | 150 | 2 | 151 | 0 |
| GR842160 | 151 | 1 | 151 | 0 |
| DB958357 | 150 | 2 | 151 | 0 |
| AW277803 | 150 | 2 | 151 | 0 |
| EG984004 | 149 | 2 | 150 | 0 |
| Orthologous Group | |||||
|---|---|---|---|---|---|
| Species | ID | ||||
| Glycine max | Glyma06g28630.1 | ||||
| Malus domestica | MDP0000178787 | ||||
| Panicum virgatum | Pavirv00020322m | ||||
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |