Basic Information | |
---|---|
Species | Glycine max |
Cazyme ID | Glyma04g13531.1 |
Family | AA6 |
Protein Properties | Length: 146 Molecular Weight: 16059.9 Isoelectric Point: 7.663 |
Chromosome | Chromosome/Scaffold: 04 Start: 13183276 End: 13183908 |
Description | flavodoxin-like quinone reductase 1 |
View CDS |
External Links |
---|
NCBI Taxonomy |
Plaza |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
AA6 | 1 | 146 | 1.4013e-45 |
MYEHVEKLADEIKKGVVFVEGVEAKLWYLKQSGYFHYVFMMFLFIQVLGKMGAPPKTDVPIMTPNELPKADGLLLGFPTRFGLMAAQFKVFMDATGGLWC TQTLAGKSAGIFYSIGSEGGGQQTTPLTSITQLVHHGMIFVPIGYS |
Full Sequence |
---|
Protein Sequence Length: 146 Download |
MYEHVEKLAD EIKKGVVFVE GVEAKLWYLK QSGYFHYVFM MFLFIQVLGK MGAPPKTDVP 60 IMTPNELPKA DGLLLGFPTR FGLMAAQFKV FMDATGGLWC TQTLAGKSAG IFYSIGSEGG 120 GQQTTPLTSI TQLVHHGMIF VPIGYS |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam03358 | FMN_red | 3.0e-7 | 6 | 145 | 142 | + NADPH-dependent FMN reductase. | ||
COG0655 | WrbA | 7.0e-19 | 1 | 145 | 152 | + Multimeric flavodoxin WrbA [General function prediction only] | ||
TIGR01755 | flav_wrbA | 6.0e-31 | 1 | 146 | 146 | + NAD(P)H:quinone oxidoreductase, type IV. This model represents a protein, WrbA, related to and slightly larger than flavodoxin. It was just shown, in E. coli and Archaeoglobus fulgidus (and previously for some eukaryotic homologs) to act as fourth type of NAD(P)H:quinone oxidoreductase. In E. coli, this protein was earlier reported to be produced during stationary phase, bind to the trp repressor, and make trp operon repression more efficient. WrbA does not interact with the trp operator by itself. Members are found in species in which homologs of the E. coli trp operon repressor TrpR are not detected [Energy metabolism, Electron transport]. | ||
PRK03767 | PRK03767 | 9.0e-34 | 1 | 146 | 146 | + NAD(P)H:quinone oxidoreductase; Provisional |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ABN12320.1 | 0 | 1 | 146 | 12 | 147 | benzoquinone reductase [Gossypium hirsutum] |
GenBank | ACU13157.1 | 0 | 2 | 146 | 14 | 148 | unknown [Glycine max] |
GenBank | ACU19740.1 | 0 | 1 | 146 | 15 | 150 | unknown [Glycine max] |
EMBL | CAD31838.1 | 0 | 2 | 146 | 14 | 148 | putative quinone oxidoreductase [Cicer arietinum] |
RefSeq | XP_002518592.1 | 0 | 2 | 146 | 13 | 147 | Flavoprotein wrbA, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3b6m_B | 1e-27 | 1 | 146 | 11 | 144 | A Chain A, Crystal Structure Of Bermuda Grass Isoallergen Bg60 Provides Insight Into The Various Cross-Allergenicity Of The Pollen Group 4 Allergens |
PDB | 3b6m_A | 1e-27 | 1 | 146 | 11 | 144 | A Chain A, Crystal Structure Of Bermuda Grass Isoallergen Bg60 Provides Insight Into The Various Cross-Allergenicity Of The Pollen Group 4 Allergens |
PDB | 3b6k_B | 1e-27 | 1 | 146 | 11 | 144 | A Chain A, Crystal Structure Of Bermuda Grass Isoallergen Bg60 Provides Insight Into The Various Cross-Allergenicity Of The Pollen Group 4 Allergens |
PDB | 3b6k_A | 1e-27 | 1 | 146 | 11 | 144 | A Chain A, Crystal Structure Of Bermuda Grass Isoallergen Bg60 Provides Insight Into The Various Cross-Allergenicity Of The Pollen Group 4 Allergens |
PDB | 3b6j_B | 1e-27 | 1 | 146 | 11 | 144 | A Chain A, Crystal Structure Of Bermuda Grass Isoallergen Bg60 Provides Insight Into The Various Cross-Allergenicity Of The Pollen Group 4 Allergens |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
GO006913 | 146 | 1 | 146 | 0 |
GO014015 | 146 | 1 | 146 | 0 |
FS321631 | 146 | 1 | 146 | 0 |
FS348216 | 146 | 1 | 146 | 0 |
GO025364 | 146 | 1 | 146 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|