Basic Information | |
---|---|
Species | Glycine max |
Cazyme ID | Glyma05g22295.1 |
Family | GH47 |
Protein Properties | Length: 95 Molecular Weight: 11241.6 Isoelectric Point: 7.5016 |
Chromosome | Chromosome/Scaffold: 05 Start: 27394035 End: 27394393 |
Description | alpha-mannosidase 2 |
View CDS |
External Links |
---|
NCBI Taxonomy |
Plaza |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH47 | 6 | 93 | 7.6e-30 |
QLAWTCYNFYQLTPTKLAGENYYFRNGHDMSVGTSWNIQRPETIESLFYLWRFTGNKTYQEWGWNIFQAFENNSRIETGYVGLKDVRN |
Full Sequence |
---|
Protein Sequence Length: 95 Download |
MHPIVQLAWT CYNFYQLTPT KLAGENYYFR NGHDMSVGTS WNIQRPETIE SLFYLWRFTG 60 NKTYQEWGWN IFQAFENNSR IETGYVGLKD VRNS* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
PTZ00470 | PTZ00470 | 1.0e-30 | 10 | 94 | 88 | + glycoside hydrolase family 47 protein; Provisional | ||
pfam01532 | Glyco_hydro_47 | 4.0e-33 | 5 | 94 | 99 | + Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2). |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004571 | mannosyl-oligosaccharide 1,2-alpha-mannosidase activity |
GO:0005509 | calcium ion binding |
GO:0016020 | membrane |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | AAF16414.1 | 0 | 6 | 91 | 415 | 500 | AF126550_1 mannosyl-oligosaccharide 1,2-alpha-mannosidase [Glycine max] |
EMBL | CBI18482.1 | 0 | 6 | 91 | 184 | 269 | unnamed protein product [Vitis vinifera] |
RefSeq | NP_001031171.1 | 0 | 6 | 91 | 300 | 385 | mannosyl-oligosaccharide 1,2-alpha-mannosidase, putative [Arabidopsis thaliana] |
RefSeq | XP_002310939.1 | 0 | 6 | 91 | 405 | 490 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002528166.1 | 0 | 6 | 91 | 362 | 447 | mannosyl-oligosaccharide alpha-1,2-mannosidase, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 1x9d_A | 0.00000000000007 | 6 | 93 | 390 | 485 | A Chain A, Crystal Structure Of Human Class I Alpha-1,2-Mannosidase In Complex With Thio-Disaccharide Substrate Analogue |
PDB | 1fmi_A | 0.0000000000001 | 6 | 93 | 312 | 407 | A Chain A, Crystal Structure Of Human Class I Alpha1,2-Mannosidase |
PDB | 1fo3_A | 0.0000000000001 | 6 | 93 | 312 | 407 | A Chain A, Crystal Structure Of Human Class I Alpha1,2-Mannosidase |
PDB | 1fo2_A | 0.0000000000001 | 6 | 93 | 312 | 407 | A Chain A, Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With 1-Deoxymannojirimycin |
PDB | 1nxc_A | 0.0000000000004 | 6 | 91 | 328 | 416 | A Chain A, Structure Of Mouse Golgi Alpha-1,2-Mannosidase Ia Reveals The Molecular Basis For Substrate Specificity Among Class I Enzymes (Family 47 Glycosidases) |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
CX286936 | 86 | 6 | 91 | 0 |
CU485778 | 86 | 6 | 91 | 0 |
CA923576 | 88 | 6 | 93 | 0 |
CX193088 | 86 | 6 | 91 | 0 |
AW830052 | 88 | 6 | 93 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|