Basic Information | |
---|---|
Species | Glycine max |
Cazyme ID | Glyma05g28310.2 |
Family | GH16 |
Protein Properties | Length: 206 Molecular Weight: 23903.9 Isoelectric Point: 9.36 |
Chromosome | Chromosome/Scaffold: 05 Start: 34159307 End: 34162225 |
Description | xyloglucan endotransglucosylase/hydrolase 16 |
View CDS |
External Links |
---|
NCBI Taxonomy |
Plaza |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH16 | 8 | 133 | 1.7e-22 |
GNSAGTVTAYYLSSQGPTHDEIDFEFLGNLSGDPYILHTNIFTQGKGNREQQFYLWFDPTRNFHTYSIIWKPQHIIFLVDNTPIRVFKNAESLGVPFPKN QPMRIYSSLWNADDWATRGGLVKTDW |
Full Sequence |
---|
Protein Sequence Length: 206 Download |
MQLKLVAGNS AGTVTAYYLS SQGPTHDEID FEFLGNLSGD PYILHTNIFT QGKGNREQQF 60 YLWFDPTRNF HTYSIIWKPQ HIIFLVDNTP IRVFKNAESL GVPFPKNQPM RIYSSLWNAD 120 DWATRGGLVK TDWSKAPFTA YYRNFKATEF SLKSSISNSG AEYEANELDS YSRRRLRWVQ 180 KYFMIYNYCS DLKRFPQGLP AECRR* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
cd00413 | Glyco_hydrolase_16 | 5.0e-19 | 9 | 127 | 127 | + glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues. | ||
cd02183 | GH16_fungal_CRH1_transglycosylase | 4.0e-29 | 4 | 151 | 163 | + glycosylphosphatidylinositol-glucanosyltransferase. Group of fungal GH16 members related to Saccharomyces cerevisiae Crh1p. Chr1p and Crh2p are transglycosylases that are required for the linkage of chitin to beta(1-3)glucose branches of beta(1-6)glucan, an important step in the assembly of new cell wall. Both have been shown to be glycosylphosphatidylinositol (GPI)-anchored. A third homologous protein, Crr1p, functions in the formation of the spore wall. They belongs to the family 16 of glycosyl hydrolases that includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues. | ||
pfam00722 | Glyco_hydro_16 | 9.0e-63 | 1 | 135 | 137 | + Glycosyl hydrolases family 16. | ||
PLN03161 | PLN03161 | 7.0e-92 | 1 | 203 | 213 | + Probable xyloglucan endotransglucosylase/hydrolase protein; Provisional | ||
cd02176 | GH16_XET | 2.0e-125 | 1 | 203 | 212 | + Xyloglucan endotransglycosylase, member of glycosyl hydrolase family 16. Xyloglucan endotransglycosylases (XETs) cleave and religate xyloglucan polymers in plant cell walls via a transglycosylation mechanism. Xyloglucan is a soluble hemicellulose with a backbone of beta-1,4-linked glucose units, partially substituted with alpha-1,6-linked xylopyranose branches. It binds noncovalently to cellulose, cross-linking the adjacent cellulose microfibrils, giving it a key structural role as a matrix polymer. Therefore, XET plays an important role in all plant processes that require cell wall remodeling. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
GO:0005618 | cell wall |
GO:0005975 | carbohydrate metabolic process |
GO:0006073 | cellular glucan metabolic process |
GO:0016762 | xyloglucan:xyloglucosyl transferase activity |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ACJ84668.1 | 0 | 1 | 203 | 78 | 281 | unknown [Medicago truncatula] |
GenBank | ACU23820.1 | 0 | 1 | 205 | 79 | 283 | unknown [Glycine max] |
GenBank | ACU24073.1 | 0 | 1 | 205 | 75 | 276 | unknown [Glycine max] |
Swiss-Prot | P35694 | 0 | 1 | 205 | 79 | 283 | BRU1_SOYBN RecName: Full=Brassinosteroid-regulated protein BRU1; Flags: Precursor |
RefSeq | XP_002518632.1 | 0 | 1 | 205 | 74 | 277 | Brassinosteroid-regulated protein BRU1 precursor, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 1un1_B | 0 | 1 | 205 | 64 | 274 | A Chain A, Crystal Structure Of Human Vps26 |
PDB | 1un1_A | 0 | 1 | 205 | 64 | 274 | A Chain A, Crystal Structure Of Human Vps26 |
PDB | 1umz_B | 0 | 1 | 205 | 64 | 274 | A Chain A, Xyloglucan Endotransglycosylase In Complex With The Xyloglucan Nonasaccharide Xllg. |
PDB | 1umz_A | 0 | 1 | 205 | 64 | 274 | A Chain A, Xyloglucan Endotransglycosylase In Complex With The Xyloglucan Nonasaccharide Xllg. |
PDB | 2uwb_B | 0 | 3 | 203 | 67 | 267 | A Chain A, Crystal Structure Of The Nasturtium Seedling Mutant Xyloglucanase Isoform Nxg1-Delta-Yniig |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
BG041541 | 201 | 2 | 202 | 0 |
BG043756 | 201 | 5 | 205 | 0 |
CX702040 | 206 | 1 | 206 | 0 |
FG861107 | 206 | 1 | 206 | 0 |
FG915560 | 206 | 1 | 206 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|