Basic Information | |
---|---|
Species | Glycine max |
Cazyme ID | Glyma06g38076.1 |
Family | AA7 |
Protein Properties | Length: 207 Molecular Weight: 22347.4 Isoelectric Point: 4.7884 |
Chromosome | Chromosome/Scaffold: 06 Start: 40854187 End: 40854915 |
Description | FAD-binding Berberine family protein |
View CDS |
External Links |
---|
NCBI Taxonomy |
Plaza |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
AA7 | 66 | 205 | 0 |
LRIRSGGHDYEGLSYVSEVETPFIIVDLSKLHAVNVDIEDNTAWIQVGATIGEVYYKIYEKSLVHGFPAGLCTSLGVGGHITGGAYGSMMRKYGLGVDNV LDARIVDANGQILDREAVGEDLFWAIRKGGGASFGILLWW |
Full Sequence |
---|
Protein Sequence Length: 207 Download |
MVSPSSNLAT LILLLSVSMA ASASFEENFV QCLSFYSDKA APFYASIYTP QNASFNKILE 60 SSTQNLRIRS GGHDYEGLSY VSEVETPFII VDLSKLHAVN VDIEDNTAWI QVGATIGEVY 120 YKIYEKSLVH GFPAGLCTSL GVGGHITGGA YGSMMRKYGL GVDNVLDARI VDANGQILDR 180 EAVGEDLFWA IRKGGGASFG ILLWWK* |
Functional Domains Download unfiltered results here | ||||||
---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description |
TIGR00387 | glcD | 6.0e-5 | 101 | 178 | 78 | + glycolate oxidase, subunit GlcD. This protein, the glycolate oxidase GlcD subunit, is similar in sequence to that of several D-lactate dehydrogenases, including that of E. coli. The glycolate oxidase has been found to have some D-lactate dehydrogenase activity [Energy metabolism, Other]. |
COG0277 | GlcD | 5.0e-16 | 66 | 205 | 149 | + FAD/FMN-containing dehydrogenases [Energy production and conversion] |
pfam01565 | FAD_binding_4 | 2.0e-21 | 66 | 179 | 115 | + FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidises the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0008762 | UDP-N-acetylmuramate dehydrogenase activity |
GO:0016491 | oxidoreductase activity |
GO:0050660 | flavin adenine dinucleotide binding |
GO:0055114 | oxidation-reduction process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
EMBL | CAN81654.1 | 0 | 11 | 206 | 12 | 243 | hypothetical protein [Vitis vinifera] |
RefSeq | XP_002268361.1 | 0 | 11 | 206 | 12 | 243 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002299035.1 | 0 | 11 | 206 | 14 | 245 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002523162.1 | 0 | 27 | 206 | 31 | 246 | Reticuline oxidase precursor, putative [Ricinus communis] |
RefSeq | XP_002523164.1 | 0 | 19 | 206 | 23 | 246 | Reticuline oxidase precursor, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 4dns_B | 0 | 14 | 206 | 26 | 221 | A Chain A, Crystal Structure Of Bermuda Grass Isoallergen Bg60 Provides Insight Into The Various Cross-Allergenicity Of The Pollen Group 4 Allergens |
PDB | 4dns_A | 0 | 14 | 206 | 26 | 221 | A Chain A, Crystal Structure Of Bermuda Grass Isoallergen Bg60 Provides Insight Into The Various Cross-Allergenicity Of The Pollen Group 4 Allergens |
PDB | 3vte_A | 0 | 6 | 206 | 17 | 218 | A Chain A, Crystal Structure Of Tetrahydrocannabinolic Acid Synthase From Cannabis Sativa |
PDB | 3tsj_B | 1.99993e-41 | 65 | 206 | 78 | 219 | A Chain A, Crystal Structure Of Tetrahydrocannabinolic Acid Synthase From Cannabis Sativa |
PDB | 3tsj_A | 1.99993e-41 | 65 | 206 | 78 | 219 | A Chain A, Crystal Structure Of Tetrahydrocannabinolic Acid Synthase From Cannabis Sativa |
Metabolic Pathways | |||
---|---|---|---|
Pathway Name | Reaction | EC | Protein Name |
cannabinoid biosynthesis | RXN-7854 | EC-1.21.3 | tetrahydrocannabinolic acid synthase |