Basic Information | |
---|---|
Species | Glycine max |
Cazyme ID | Glyma06g40810.2 |
Family | AA6 |
Protein Properties | Length: 168 Molecular Weight: 18032.5 Isoelectric Point: 6.6799 |
Chromosome | Chromosome/Scaffold: 06 Start: 43998473 End: 43999283 |
Description | flavodoxin-like quinone reductase 1 |
View CDS |
External Links |
---|
NCBI Taxonomy |
Plaza |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
AA6 | 1 | 160 | 0 |
KQVPETLPSEELAKLRALPKSIVPIIHPNQLPEADSFIFGFPTRFGMMAAQFKAFLDSTEELCKTQRLAGKSAGIITSTSSQGGGQETTVLTAITPLAHH GMIFVPFGIRFAYSNEFGNVKEVKGGSPYGAGTYAETEGPTSIESMHAFDHGYYFANITK |
Full Sequence |
---|
Protein Sequence Length: 168 Download |
KQVPETLPSE ELAKLRALPK SIVPIIHPNQ LPEADSFIFG FPTRFGMMAA QFKAFLDSTE 60 ELCKTQRLAG KSAGIITSTS SQGGGQETTV LTAITPLAHH GMIFVPFGIR FAYSNEFGNV 120 KEVKGGSPYG AGTYAETEGP TSIESMHAFD HGYYFANITK QLKEATA* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam03358 | FMN_red | 0.0002 | 33 | 113 | 84 | + NADPH-dependent FMN reductase. | ||
COG0655 | WrbA | 3.0e-16 | 33 | 164 | 136 | + Multimeric flavodoxin WrbA [General function prediction only] | ||
TIGR01755 | flav_wrbA | 2.0e-30 | 1 | 162 | 165 | + NAD(P)H:quinone oxidoreductase, type IV. This model represents a protein, WrbA, related to and slightly larger than flavodoxin. It was just shown, in E. coli and Archaeoglobus fulgidus (and previously for some eukaryotic homologs) to act as fourth type of NAD(P)H:quinone oxidoreductase. In E. coli, this protein was earlier reported to be produced during stationary phase, bind to the trp repressor, and make trp operon repression more efficient. WrbA does not interact with the trp operator by itself. Members are found in species in which homologs of the E. coli trp operon repressor TrpR are not detected [Energy metabolism, Electron transport]. | ||
PRK03767 | PRK03767 | 5.0e-34 | 1 | 163 | 166 | + NAD(P)H:quinone oxidoreductase; Provisional |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0009055 | electron carrier activity |
GO:0016491 | oxidoreductase activity |
GO:0050662 | coenzyme binding |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | AAO12869.1 | 0 | 2 | 165 | 2 | 165 | putative quinone reductase [Vitis vinifera] |
GenBank | ACJ86051.1 | 0 | 2 | 165 | 39 | 202 | unknown [Medicago truncatula] |
GenBank | ACU13985.1 | 0 | 2 | 165 | 39 | 202 | unknown [Glycine max] |
RefSeq | XP_002319258.1 | 0 | 2 | 165 | 39 | 202 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002534445.1 | 0 | 2 | 163 | 39 | 200 | Minor allergen Alt a, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3b6m_B | 5e-30 | 1 | 163 | 37 | 197 | B Chain B, Structure Of A Cellulose Synthase - Cellulose Translocation Intermediate |
PDB | 3b6m_A | 5e-30 | 1 | 163 | 37 | 197 | B Chain B, Structure Of A Cellulose Synthase - Cellulose Translocation Intermediate |
PDB | 3b6k_B | 5e-30 | 1 | 163 | 37 | 197 | B Chain B, Structure Of A Cellulose Synthase - Cellulose Translocation Intermediate |
PDB | 3b6k_A | 5e-30 | 1 | 163 | 37 | 197 | B Chain B, Structure Of A Cellulose Synthase - Cellulose Translocation Intermediate |
PDB | 3b6j_B | 5e-30 | 1 | 163 | 37 | 197 | B Chain B, Structure Of A Cellulose Synthase - Cellulose Translocation Intermediate |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
FK004621 | 166 | 2 | 165 | 0 |
FK004620 | 166 | 2 | 165 | 0 |
FG846536 | 166 | 2 | 165 | 0 |
FG892684 | 166 | 2 | 165 | 0 |
FS977959 | 166 | 2 | 164 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|