CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma08g03210.1
FamilyGH13
Protein PropertiesLength: 799 Molecular Weight: 89855.3 Isoelectric Point: 5.719
ChromosomeChromosome/Scaffold: 08 Start: 2261024 End: 2271853
Descriptionisoamylase 1
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH132516370
  KFPGTYLGVVEKLDHLKELGVNCLELMPCHEFNELEYYGHNSAQGDYRVNFWGYSTINYFSPMIRYSSAGIRNCGQDGINEIKFLIKEAHKRGIEVIMDV
  VFNHTAEGNENGPIISFRGVDNSMYYMLAPKGEFYNYSGCGNTFNCNHPVVRQFIVDCLRYWVTEMHVDGFRFDLASIMTRSSSLWDGANVFGAPIEGDL
  LTTGTPLSSPPLIDLISNDPILCGVKLIAEAWDAGGLYQVGTFPHWGIWSEWNGKYRDTVRLFIKGTDGFAGAFAECLCGSPNLYQGGGRKPWHSINFVC
  AHDGFTLADLVTYNNKNNLSNGEDNNDGENHNNSWNCGQEGEFVSTSVKKLRKRQMRNFFLSLMVSQGVPMIYMGDEYGHTKGGNNN
Full Sequence
Protein Sequence     Length: 799     Download
MPMACFSILS PPHPTLTLTL LPPSHSQCGG FTVRVSVALT ERLSQHHKTN SIIPSTRAAA    60
NGGGFETETA VVEKPQLKTL FQASRGYPSP FGATVRDGGV NFAISSLNAL SATLCFFTLS    120
DFQNNRVTEY VPLDPLINRT GGVWHVFLKG DFRDMLYGYK FDGKFSPLEG HYFDSSHILL    180
DPYAKAVISR GEFGALGPDG NCWPQMAGTV PSEDDEFDWE GDLPLKYPQK DLVIYEMHVR    240
GFTKHESSNT KFPGTYLGVV EKLDHLKELG VNCLELMPCH EFNELEYYGH NSAQGDYRVN    300
FWGYSTINYF SPMIRYSSAG IRNCGQDGIN EIKFLIKEAH KRGIEVIMDV VFNHTAEGNE    360
NGPIISFRGV DNSMYYMLAP KGEFYNYSGC GNTFNCNHPV VRQFIVDCLR YWVTEMHVDG    420
FRFDLASIMT RSSSLWDGAN VFGAPIEGDL LTTGTPLSSP PLIDLISNDP ILCGVKLIAE    480
AWDAGGLYQV GTFPHWGIWS EWNGKYRDTV RLFIKGTDGF AGAFAECLCG SPNLYQGGGR    540
KPWHSINFVC AHDGFTLADL VTYNNKNNLS NGEDNNDGEN HNNSWNCGQE GEFVSTSVKK    600
LRKRQMRNFF LSLMVSQGVP MIYMGDEYGH TKGGNNNTYC HDNYHNYFQW DKKEESSSDF    660
FRFCRLMTKF RQECESLGLA DFPTSERLQW HGHFPGKPDW SETSRFVACT MVDSVKGEIY    720
IAFNMSHLPF TVTLPERPGY KWEPLVDTSK PTPYDFLTPD LPGRDIAIQQ YAQFLDANMY    780
PMLSYSSIIL LRIPDENL* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK14510PRK145106.0e-12586739690+
PRK03705PRK037058.0e-13986660594+
cd11326AmyAc_Glg_debranch0217673462+
COG1523PulA086772715+
TIGR02100glgX_debranch086753708+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
GO:0043169cation binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAZ81835.103479738790isoamylase isoform 1 [Pisum sativum]
DDBJBAF52941.1037971790isoamylase-type starch-debranching enzyme 1 [Phaseolus vulgaris]
EMBLCBI40669.105879763808unnamed protein product [Vitis vinifera]
RefSeqXP_002308090.103479731825predicted protein [Populus trichocarpa]
RefSeqXP_002324659.105579753793predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vuy_B08671915647A Chain A, Crystal Structure Of Puromycin Hydrolase S511a Mutant
PDB2vuy_A08671915647A Chain A, Crystal Structure Of Puromycin Hydrolase S511a Mutant
PDB2vr5_B08671915647A Chain A, Crystal Structure Of Puromycin Hydrolase S511a Mutant
PDB2vr5_A08671915647A Chain A, Crystal Structure Of Puromycin Hydrolase S511a Mutant
PDB2vnc_B08671915647A Chain A, Crystal Structure Of Glycogen Debranching Enzyme Trex From Sulfolobus Solfataricus
Metabolic Pathways
Pathway NameReactionECProtein Name
starch degradation IIRXN-12280EC-3.2.1.68isoamylase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO8002352654937570
HO8002351193194370
HO800235524414920
HO4312284243727950
HO7804882204256440
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00091.4Aquca_014_00091.1Aquca_014_00091.3Aquca_014_00091.2Aquca_014_00091.5
Aquca_014_00091.6Aquca_014_00091.7Aquca_018_00158.1Aquca_018_00158.2Aquca_014_00091.8
Aquca_026_00010.1
Arabidopsis lyrata911044483030470308
Arabidopsis thalianaAT4G09020.1AT2G39930.1AT1G03310.2AT1G03310.1
Brachypodium distachyonBradi4g32707.2Bradi4g32707.1Bradi3g40410.2Bradi3g40410.1Bradi2g26170.1
Brassica rapaBra000667Bra005001Bra030528Bra033388
Carica papayaevm.model.supercontig_36.185evm.model.supercontig_485.4evm.model.supercontig_115.45
Capsella rubellaCarubv10003443mCarubv10024947mCarubv10012076m
Chlamydomonas reinhardtiig4436.t1g3160.t1
Citrus clementinaCiclev10000452mCiclev10000347mCiclev10007489mCiclev10023436m
Citrus sinensisorange1.1g009902morange1.1g006791morange1.1g003977morange1.1g011993morange1.1g005976m
orange1.1g003653morange1.1g003901morange1.1g005552morange1.1g047308m
Cucumis sativusCucsa.311690.1Cucsa.281840.2Cucsa.281840.1Cucsa.084930.1
Eucalyptus grandisEucgr.B00043.1Eucgr.C02189.3Eucgr.C02189.2Eucgr.C02189.1Eucgr.K03392.1
Fragaria vescamrna11912.1-v1.0-hybridmrna12022.1-v1.0-hybridmrna27855.1-v1.0-hybrid
Glycine maxGlyma06g10540.2Glyma04g10693.3Glyma04g10693.2Glyma04g10693.1Glyma08g03210.2
Glyma03g30771.1Glyma19g33620.2
Gossypium raimondiiGorai.009G233800.1Gorai.009G233800.2Gorai.009G233800.3Gorai.012G008800.3Gorai.012G008800.2
Gorai.012G008800.1Gorai.007G134600.3Gorai.007G134600.2Gorai.007G134600.1
Linum usitatissimumLus10036474Lus10021586Lus10000661Lus10027999Lus10017150
Malus domesticaMDP0000119748MDP0000118987MDP0000313388MDP0000185233MDP0000647541
MDP0000258604MDP0000238431
Manihot esculentacassava4.1_001932mcassava4.1_001414m
Medicago truncatulaMedtr3g099500.1Medtr8g101490.1
Mimulus guttatusmgv1a002417mmgv1a001549mmgv1a001869m
Oryza sativaLOC_Os08g40930.1LOC_Os09g29404.3LOC_Os09g29404.1LOC_Os05g32710.1
Panicum virgatumPavirv00034683mPavirv00034682mPavirv00063957mPavirv00032505mPavirv00012813m
Physcomitrella patensPp1s25_63V6.1Pp1s36_254V6.2Pp1s36_254V6.1Pp1s62_201V6.2
Phaseolus vulgarisPhvul.009G033200.1Phvul.002G303600.1Phvul.001G148700.1Phvul.005G040300.1
Picea abiesMA_10431226g0020MA_159157g0180
Populus trichocarpaPotri.002G100900.2Potri.002G100900.4Potri.002G100900.3Potri.002G100900.1Potri.006G070800.3
Potri.006G070800.2Potri.006G070800.1Potri.018G132500.4Potri.018G132500.3Potri.018G132500.2
Potri.018G132500.1Potri.018G132500.5Potri.002G215400.1Potri.002G219900.1
Prunus persicappa001639mppa025097mppa001199m
Ricinus communis29908.m00608929776.m00048828153.m00028728323.m00004135877.m000015
27724.m00001829104.m000024
Setaria italicaSi029005mSi013277m
Selaginella moellendorffii10621875877414611
Sorghum bicolorSb02g027280.3Sb02g027280.2Sb02g027280.1Sb07g027200.1Sb09g019480.1
Thellungiella halophilaThhalv10028487mThhalv10028455mThhalv10028452mThhalv10016275mThhalv10006762m
Vitis viniferaGSVIVT01009087001GSVIVT01035168001GSVIVT01011096001
Volvox carteriVocar20007238mVocar20007651m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)