| Basic Information | |
|---|---|
| Species | Glycine max |
| Cazyme ID | Glyma08g11825.1 |
| Family | CBM43 |
| Protein Properties | Length: 100 Molecular Weight: 10186.2 Isoelectric Point: 7.8637 |
| Chromosome | Chromosome/Scaffold: 08 Start: 8609441 End: 8610027 |
| Description | Carbohydrate-binding X8 domain superfamily protein |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| Plaza |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| CBM43 | 4 | 79 | 2.6e-30 |
| NAGYGALKSGLAFACSHGADCRAIQPGGSCFNPNTIQNHASYAFDSYYQTHAKNPAACNFGGTATIAVTNPSFGRC | |||
| Full Sequence |
|---|
| Protein Sequence Length: 100 Download |
| ARSNAGYGAL KSGLAFACSH GADCRAIQPG GSCFNPNTIQ NHASYAFDSY YQTHAKNPAA 60 CNFGGTATIA VTNPSFGRCV YPPFSSTDGG VDTTITGLQ* 120 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam07983 | X8 | 4.0e-15 | 1 | 68 | 73 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
| smart00768 | X8 | 1.0e-31 | 1 | 81 | 81 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ABK28115.1 | 7e-25 | 10 | 81 | 41 | 112 | unknown [Arabidopsis thaliana] |
| GenBank | ACU17645.1 | 7e-28 | 1 | 90 | 33 | 122 | unknown [Glycine max] |
| RefSeq | NP_001118954.1 | 7e-25 | 10 | 81 | 41 | 112 | unknown protein [Arabidopsis thaliana] |
| RefSeq | NP_193096.5 | 1e-25 | 1 | 96 | 64 | 159 | unknown protein [Arabidopsis thaliana] |
| RefSeq | XP_002267551.1 | 1e-24 | 1 | 93 | 53 | 145 | PREDICTED: hypothetical protein [Vitis vinifera] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2jon_A | 1e-19 | 10 | 82 | 25 | 97 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
| Hit | Length | Start | End | EValue |
| GO030180 | 97 | 1 | 95 | 7e-39 |
| GO020080 | 97 | 1 | 95 | 1e-38 |
| GW897768 | 89 | 1 | 89 | 3e-37 |
| EG984662 | 95 | 1 | 95 | 2e-32 |
| EG987006 | 95 | 1 | 95 | 3e-32 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
