Basic Information | |
---|---|
Species | Glycine max |
Cazyme ID | Glyma08g11825.1 |
Family | CBM43 |
Protein Properties | Length: 100 Molecular Weight: 10186.2 Isoelectric Point: 7.8637 |
Chromosome | Chromosome/Scaffold: 08 Start: 8609441 End: 8610027 |
Description | Carbohydrate-binding X8 domain superfamily protein |
View CDS |
External Links |
---|
NCBI Taxonomy |
Plaza |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 4 | 79 | 2.6e-30 |
NAGYGALKSGLAFACSHGADCRAIQPGGSCFNPNTIQNHASYAFDSYYQTHAKNPAACNFGGTATIAVTNPSFGRC |
Full Sequence |
---|
Protein Sequence Length: 100 Download |
ARSNAGYGAL KSGLAFACSH GADCRAIQPG GSCFNPNTIQ NHASYAFDSY YQTHAKNPAA 60 CNFGGTATIA VTNPSFGRCV YPPFSSTDGG VDTTITGLQ* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 4.0e-15 | 1 | 68 | 73 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 1.0e-31 | 1 | 81 | 81 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ABK28115.1 | 7e-25 | 10 | 81 | 41 | 112 | unknown [Arabidopsis thaliana] |
GenBank | ACU17645.1 | 7e-28 | 1 | 90 | 33 | 122 | unknown [Glycine max] |
RefSeq | NP_001118954.1 | 7e-25 | 10 | 81 | 41 | 112 | unknown protein [Arabidopsis thaliana] |
RefSeq | NP_193096.5 | 1e-25 | 1 | 96 | 64 | 159 | unknown protein [Arabidopsis thaliana] |
RefSeq | XP_002267551.1 | 1e-24 | 1 | 93 | 53 | 145 | PREDICTED: hypothetical protein [Vitis vinifera] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 1e-19 | 10 | 82 | 25 | 97 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
GO030180 | 97 | 1 | 95 | 7e-39 |
GO020080 | 97 | 1 | 95 | 1e-38 |
GW897768 | 89 | 1 | 89 | 3e-37 |
EG984662 | 95 | 1 | 95 | 2e-32 |
EG987006 | 95 | 1 | 95 | 3e-32 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|