| Basic Information | |
|---|---|
| Species | Glycine max |
| Cazyme ID | Glyma08g15960.5 |
| Family | GH1 |
| Protein Properties | Length: 141 Molecular Weight: 15977.2 Isoelectric Point: 9.4953 |
| Chromosome | Chromosome/Scaffold: 08 Start: 11652987 End: 11655213 |
| Description | beta glucosidase 17 |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| Plaza |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH1 | 1 | 139 | 2.2e-30 |
| MKSSVGSRLPKFTKAESEGLKNSIDFLGVNYYTTYYAEHAEPVSANRTFYTDILASLSTERNGLHVGTPTDLNWLFIFPKGIHLLMAHIKDKYKNLPIYI TENGMAESRNDSIPVNEARKDSIRIRYHDGHLKFLLQAI | |||
| Full Sequence |
|---|
| Protein Sequence Length: 141 Download |
| MKSSVGSRLP KFTKAESEGL KNSIDFLGVN YYTTYYAEHA EPVSANRTFY TDILASLSTE 60 RNGLHVGTPT DLNWLFIFPK GIHLLMAHIK DKYKNLPIYI TENGMAESRN DSIPVNEARK 120 DSIRIRYHDG HLKFLLQAIK * |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN02998 | PLN02998 | 1.0e-15 | 1 | 140 | 142 | + beta-glucosidase | ||
| PLN02849 | PLN02849 | 4.0e-16 | 1 | 140 | 143 | + beta-glucosidase | ||
| TIGR03356 | BGL | 1.0e-16 | 9 | 140 | 133 | + beta-galactosidase. | ||
| PLN02814 | PLN02814 | 8.0e-20 | 1 | 140 | 145 | + beta-glucosidase | ||
| pfam00232 | Glyco_hydro_1 | 9.0e-28 | 1 | 139 | 141 | + Glycosyl hydrolase family 1. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ABD03937.1 | 0 | 1 | 140 | 315 | 454 | vicianin hydrolase [Vicia sativa subsp. nigra] |
| GenBank | ACU18054.1 | 0 | 1 | 140 | 1 | 140 | unknown [Glycine max] |
| RefSeq | XP_002330884.1 | 5.60519e-45 | 1 | 140 | 315 | 455 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002334229.1 | 0 | 1 | 140 | 72 | 212 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002512142.1 | 1.4013e-45 | 1 | 140 | 315 | 454 | beta-glucosidase, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3ptq_B | 4e-33 | 1 | 140 | 310 | 450 | A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12 |
| PDB | 3ptq_A | 4e-33 | 1 | 140 | 310 | 450 | A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12 |
| PDB | 3ptm_B | 4e-33 | 1 | 140 | 310 | 450 | A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12 |
| PDB | 3ptm_A | 4e-33 | 1 | 140 | 310 | 450 | A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12 |
| PDB | 3ptk_B | 4e-33 | 1 | 140 | 310 | 450 | A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12 |
| Metabolic Pathways | |||
|---|---|---|---|
| Pathway Name | Reaction | EC | Protein Name |
| coumarin biosynthesis (via 2-coumarate) | RXN-8036 | EC-3.2.1.21 | β-glucosidase |
| linamarin degradation | RXN-5341 | EC-3.2.1.21 | β-glucosidase |
| linustatin bioactivation | RXN-13602 | EC-3.2.1.21 | β-glucosidase |
| linustatin bioactivation | RXN-5341 | EC-3.2.1.21 | β-glucosidase |
| lotaustralin degradation | RXN-9674 | EC-3.2.1.21 | β-glucosidase |
| neolinustatin bioactivation | RXN-13603 | EC-3.2.1.21 | β-glucosidase |
| neolinustatin bioactivation | RXN-9674 | EC-3.2.1.21 | β-glucosidase |
| taxiphyllin bioactivation | RXN-13600 | EC-3.2.1.21 | β-glucosidase |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| AW831770 | 140 | 1 | 140 | 0 |
| BF069240 | 140 | 1 | 140 | 0 |
| AI900801 | 140 | 1 | 140 | 0 |
| BE329786 | 140 | 1 | 140 | 0 |
| CF806342 | 140 | 1 | 140 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |