| Basic Information | |
|---|---|
| Species | Glycine max |
| Cazyme ID | Glyma08g25901.1 |
| Family | GH28 |
| Protein Properties | Length: 155 Molecular Weight: 17057.2 Isoelectric Point: 7.2031 |
| Chromosome | Chromosome/Scaffold: 08 Start: 20315298 End: 20316072 |
| Description | Pectin lyase-like superfamily protein |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| Plaza |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH28 | 2 | 149 | 7.1e-34 |
| TFMLKPLQFSCPCSFSLVHFQVEGDVVTPKSTEAWKGQDSSKWIDFSNVNGLIIDEGGQIDGSGSIWWNSCKVKCCLRPTALSIHNCNNLQLTGIRHLNS ARNHISINNSNHNHIFNVNIDAPLDSPNINGIDVSQSSYTLIQHSTIA | |||
| Full Sequence |
|---|
| Protein Sequence Length: 155 Download |
| ETFMLKPLQF SCPCSFSLVH FQVEGDVVTP KSTEAWKGQD SSKWIDFSNV NGLIIDEGGQ 60 IDGSGSIWWN SCKVKCCLRP TALSIHNCNN LQLTGIRHLN SARNHISINN SNHNHIFNVN 120 IDAPLDSPNI NGIDVSQSSY TLIQHSTIAI GKRH* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam00295 | Glyco_hydro_28 | 7.0e-16 | 2 | 151 | 153 | + Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes is important in cell wall metabolism. | ||
| PLN02218 | PLN02218 | 9.0e-18 | 2 | 151 | 157 | + polygalacturonase ADPG | ||
| PLN02793 | PLN02793 | 2.0e-22 | 2 | 151 | 155 | + Probable polygalacturonase | ||
| PLN03010 | PLN03010 | 4.0e-23 | 1 | 151 | 151 | + polygalacturonase | ||
| PLN03003 | PLN03003 | 5.0e-27 | 2 | 151 | 150 | + Probable polygalacturonase At3g15720 | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004650 | polygalacturonase activity |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | AAY21049.1 | 2e-34 | 1 | 151 | 72 | 226 | PGN [Glycine max] |
| GenBank | ABC75354.1 | 3e-36 | 1 | 151 | 65 | 214 | Glycoside hydrolase, family 28 [Medicago truncatula] |
| GenBank | ABO81149.1 | 0 | 1 | 151 | 40 | 191 | Glycoside hydrolase, family 28 [Medicago truncatula] |
| RefSeq | NP_197222.1 | 2e-31 | 1 | 151 | 80 | 224 | glycoside hydrolase family 28 protein / polygalacturonase (pectinase) family protein [Arabidopsis thaliana] |
| RefSeq | XP_002515526.1 | 4e-34 | 1 | 151 | 69 | 216 | Polygalacturonase-2 precursor, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 1nhc_F | 0.002 | 53 | 148 | 72 | 171 | A Chain A, Structural Insights Into The Processivity Of Endopolygalacturonase I From Aspergillus Niger |
| PDB | 1nhc_E | 0.002 | 53 | 148 | 72 | 171 | A Chain A, Structural Insights Into The Processivity Of Endopolygalacturonase I From Aspergillus Niger |
| PDB | 1nhc_D | 0.002 | 53 | 148 | 72 | 171 | A Chain A, Structural Insights Into The Processivity Of Endopolygalacturonase I From Aspergillus Niger |
| PDB | 1nhc_C | 0.002 | 53 | 148 | 72 | 171 | A Chain A, Structural Insights Into The Processivity Of Endopolygalacturonase I From Aspergillus Niger |
| PDB | 1nhc_B | 0.002 | 53 | 148 | 72 | 171 | A Chain A, Structural Insights Into The Processivity Of Endopolygalacturonase I From Aspergillus Niger |
| Metabolic Pathways | |||
|---|---|---|---|
| Pathway Name | Reaction | EC | Protein Name |
| homogalacturonan degradation | RXN-2103 | EC-3.2.1.15 | polygalacturonase |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| CV538127 | 153 | 1 | 151 | 1e-28 |
| GE483973 | 156 | 2 | 151 | 9e-28 |
| EY945917 | 151 | 1 | 151 | 7e-26 |
| EY950069 | 151 | 1 | 151 | 7e-26 |
| CX192293 | 151 | 1 | 151 | 4e-25 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |