| Basic Information | |
|---|---|
| Species | Glycine max |
| Cazyme ID | Glyma10g39121.2 |
| Family | GH35 |
| Protein Properties | Length: 107 Molecular Weight: 12363.4 Isoelectric Point: 7.5009 |
| Chromosome | Chromosome/Scaffold: 10 Start: 46830009 End: 46834532 |
| Description | beta-galactosidase 12 |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| Plaza |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH35 | 32 | 106 | 8.7e-35 |
| IHYPRSTPKMWPDLIQKSKDGGLDVIETYVFWNLREPVRGQYNFEGRCDLIKFVKVVAAAGPYVHLQIGPYACAE | |||
| Full Sequence |
|---|
| Protein Sequence Length: 107 Download |
| MPLLRLEQMS RMTTEHWPLM ASAESWYLVL YIHYPRSTPK MWPDLIQKSK DGGLDVIETY 60 VFWNLREPVR GQYNFEGRCD LIKFVKVVAA AGPYVHLQIG PYACAE* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam02449 | Glyco_hydro_42 | 0.003 | 33 | 97 | 66 | + Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues. | ||
| COG1874 | LacA | 4.0e-6 | 32 | 106 | 77 | + Beta-galactosidase [Carbohydrate transport and metabolism] | ||
| pfam01301 | Glyco_hydro_35 | 2.0e-38 | 32 | 106 | 75 | + Glycosyl hydrolases family 35. | ||
| PLN03059 | PLN03059 | 2.0e-39 | 32 | 106 | 75 | + beta-galactosidase; Provisional | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0004565 | beta-galactosidase activity |
| GO:0005975 | carbohydrate metabolic process |
| GO:0009341 | beta-galactosidase complex |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ACJ86220.1 | 1.99965e-42 | 10 | 106 | 24 | 121 | unknown [Medicago truncatula] |
| GenBank | ACJ86256.1 | 1e-38 | 32 | 106 | 43 | 117 | unknown [Medicago truncatula] |
| EMBL | CAC44501.1 | 5e-38 | 32 | 106 | 51 | 125 | beta-galactosidase [Fragaria x ananassa] |
| EMBL | CBI16297.1 | 5e-38 | 10 | 106 | 24 | 121 | unnamed protein product [Vitis vinifera] |
| RefSeq | XP_002530296.1 | 2e-37 | 10 | 106 | 23 | 120 | beta-galactosidase, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3d3a_A | 0.00000000000008 | 32 | 106 | 29 | 103 | A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron |
| PDB | 4e8d_B | 0.0000000000008 | 32 | 106 | 24 | 98 | A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron |
| PDB | 4e8d_A | 0.0000000000008 | 32 | 106 | 24 | 98 | A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron |
| PDB | 4e8c_B | 0.0000000000008 | 32 | 106 | 24 | 98 | A Chain A, Crystal Structure Of Streptococcal Beta-Galactosidase In Complex With Galactose |
| PDB | 4e8c_A | 0.0000000000008 | 32 | 106 | 24 | 98 | A Chain A, Crystal Structure Of Streptococcal Beta-Galactosidase In Complex With Galactose |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| BE660170 | 98 | 10 | 106 | 4.06377e-44 |
| AV781316 | 98 | 10 | 106 | 5.00264e-43 |
| BW678935 | 98 | 10 | 106 | 8.99634e-43 |
| BE660170 | 32 | 1 | 32 | 0.00000000005 |
| BW678935 | 32 | 1 | 32 | 0.000006 |
| Orthologous Group | |||||
|---|---|---|---|---|---|
| Species | ID | ||||
| Glycine max | Glyma10g39121.1 | ||||
| Sequence Alignments |
|---|
 |
| Phylogeny |
|---|
 |