y
Basic Information | |
---|---|
Species | Glycine max |
Cazyme ID | Glyma11g13766.2 |
Family | GH1 |
Protein Properties | Length: 130 Molecular Weight: 14975.1 Isoelectric Point: 10.1002 |
Chromosome | Chromosome/Scaffold: 11 Start: 9794153 End: 9794936 |
Description | beta glucosidase 17 |
View CDS |
External Links |
---|
NCBI Taxonomy |
Plaza |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH1 | 1 | 116 | 2e-26 |
MEPLTKGEYPRNMRALVGSRLPKFSKWQAKLVNGSFDFIGLNYYSSGYINGVPPSNAKPSFLTDSRTNTTFERNGRPLGLRAASNWIYFYPKGLRDLLLY TKDKYNNPLIYITENG |
Full Sequence |
---|
Protein Sequence Length: 130 Download |
MEPLTKGEYP RNMRALVGSR LPKFSKWQAK LVNGSFDFIG LNYYSSGYIN GVPPSNAKPS 60 FLTDSRTNTT FERNGRPLGL RAASNWIYFY PKGLRDLLLY TKDKYNNPLI YITENGKYAL 120 IHYVYFYFT* 180 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
PLN02849 | PLN02849 | 2.0e-15 | 1 | 117 | 120 | + beta-glucosidase | ||
PLN02998 | PLN02998 | 1.0e-15 | 1 | 117 | 117 | + beta-glucosidase | ||
TIGR03356 | BGL | 8.0e-16 | 1 | 116 | 119 | + beta-galactosidase. | ||
PLN02814 | PLN02814 | 1.0e-16 | 1 | 117 | 121 | + beta-glucosidase | ||
pfam00232 | Glyco_hydro_1 | 6.0e-27 | 1 | 116 | 118 | + Glycosyl hydrolase family 1. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
GO:0005975 | carbohydrate metabolic process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ABI34907.3 | 0 | 1 | 116 | 186 | 302 | glycoside hydrolase family 1 protein [Leucaena leucocephala] |
GenBank | ABY48758.1 | 0 | 1 | 116 | 299 | 415 | glycosylhydrolase 1 [Leucaena leucocephala] |
GenBank | ABY84677.1 | 2.8026e-45 | 1 | 116 | 202 | 318 | coniferrin beta glucosidase [Leucaena leucocephala] |
GenBank | ACD65511.1 | 0 | 1 | 116 | 308 | 424 | beta-glucosidase D7 [Lotus japonicus] |
DDBJ | BAF34333.1 | 0 | 1 | 116 | 307 | 422 | isoflavone conjugate-specific beta-glucosidase [Glycine max] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3ptq_B | 3.00018e-42 | 1 | 116 | 298 | 414 | A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12 |
PDB | 3ptq_A | 3.00018e-42 | 1 | 116 | 298 | 414 | A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12 |
PDB | 3ptm_B | 3.00018e-42 | 1 | 116 | 298 | 414 | A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12 |
PDB | 3ptm_A | 3.00018e-42 | 1 | 116 | 298 | 414 | A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12 |
PDB | 3ptk_B | 3.00018e-42 | 1 | 116 | 298 | 414 | A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12 |
Metabolic Pathways | |||
---|---|---|---|
Pathway Name | Reaction | EC | Protein Name |
coumarin biosynthesis (via 2-coumarate) | RXN-8036 | EC-3.2.1.21 | β-glucosidase |
linamarin degradation | RXN-5341 | EC-3.2.1.21 | β-glucosidase |
linustatin bioactivation | RXN-13602 | EC-3.2.1.21 | β-glucosidase |
linustatin bioactivation | RXN-5341 | EC-3.2.1.21 | β-glucosidase |
lotaustralin degradation | RXN-9674 | EC-3.2.1.21 | β-glucosidase |
neolinustatin bioactivation | RXN-13603 | EC-3.2.1.21 | β-glucosidase |
neolinustatin bioactivation | RXN-9674 | EC-3.2.1.21 | β-glucosidase |
taxiphyllin bioactivation | RXN-13600 | EC-3.2.1.21 | β-glucosidase |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
BE020620 | 116 | 1 | 116 | 0 |
AW101440 | 116 | 1 | 116 | 0 |
AI736444 | 116 | 1 | 116 | 0 |
BQ453497 | 116 | 1 | 116 | 0 |
CX711042 | 116 | 1 | 116 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|