Basic Information | |
---|---|
Species | Glycine max |
Cazyme ID | Glyma11g15680.5 |
Family | AA2 |
Protein Properties | Length: 251 Molecular Weight: 27051.6 Isoelectric Point: 5.6042 |
Chromosome | Chromosome/Scaffold: 11 Start: 11351762 End: 11354492 |
Description | ascorbate peroxidase 1 |
View CDS |
External Links |
---|
NCBI Taxonomy |
Plaza |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
AA2 | 22 | 246 | 0 |
KLRGFIAEKRCAPLMLRLAWHSAGTFDKGTKTGGPFGTIKHPAELAHSANNGLDIAVRLLEPLKAEFPILSYADFYQLAGVVAVEVTGGPEVPFHPGRED KPEPPPEGRLPDATKGSDHLRDVFGKAMGLTDQDIVALSGGHTIGAAHKERSGFEGPWTSNPLIFDNSYFTELLSGEKEGLLQLPSDKALLSDPVFRPLV DKYAADEDAFFADYAEAHQKLSELG |
Full Sequence |
---|
Protein Sequence Length: 251 Download |
MGKSYPTVSA DYQKAVEKAK KKLRGFIAEK RCAPLMLRLA WHSAGTFDKG TKTGGPFGTI 60 KHPAELAHSA NNGLDIAVRL LEPLKAEFPI LSYADFYQLA GVVAVEVTGG PEVPFHPGRE 120 DKPEPPPEGR LPDATKGSDH LRDVFGKAMG LTDQDIVALS GGHTIGAAHK ERSGFEGPWT 180 SNPLIFDNSY FTELLSGEKE GLLQLPSDKA LLSDPVFRPL VDKYAADEDA FFADYAEAHQ 240 KLSELGFADA * |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
cd00314 | plant_peroxidase_like | 4.0e-53 | 17 | 223 | 235 | + Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase. | ||
PLN02608 | PLN02608 | 3.0e-125 | 6 | 247 | 242 | + L-ascorbate peroxidase | ||
PLN02364 | PLN02364 | 9.0e-130 | 1 | 250 | 250 | + L-ascorbate peroxidase 1 | ||
PLN02879 | PLN02879 | 2.0e-132 | 1 | 249 | 249 | + L-ascorbate peroxidase | ||
cd00691 | ascorbate_peroxidase | 4.0e-133 | 5 | 250 | 254 | + Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004601 | peroxidase activity |
GO:0006979 | response to oxidative stress |
GO:0020037 | heme binding |
GO:0055114 | oxidation-reduction process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 1OAF | 0 | 2 | 250 | 13 | 261 | A Chain A, Ascobate Peroxidase From Soybean Cytosol In Complex With Ascorbate |
PDB | 2CL4 | 0 | 2 | 250 | 13 | 261 | X Chain X, Ascorbate Peroxidase R172a Mutant |
PDB | 2VCF | 0 | 2 | 250 | 13 | 261 | X Chain X, Structure Of Isoniazid (Inh) Bound To Cytosolic Soybean Ascorbate Peroxidase |
PDB | 2VCS | 0 | 2 | 250 | 13 | 261 | A Chain A, Structure Of Isoniazid (Inh) Bound To Cytosolic Soybean Ascorbate Peroxidase Mutant H42a |
GenBank | AAA61779.1 | 0 | 1 | 250 | 1 | 250 | ascorbate peroxidase [Glycine max] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2xj6_A | 0 | 2 | 250 | 1 | 249 | X Chain X, Crystal Structure Of The Full-Length Autotransporter Esta From Pseudomonas Aeruginosa |
PDB | 2xih_A | 0 | 2 | 250 | 1 | 249 | X Chain X, Crystal Structure Of The Full-Length Autotransporter Esta From Pseudomonas Aeruginosa |
PDB | 2xif_A | 0 | 2 | 250 | 1 | 249 | A Chain A, The Structure Of Ascorbate Peroxidase Compound Ii |
PDB | 2xi6_A | 0 | 2 | 250 | 1 | 249 | A Chain A, The Structure Of Ascorbate Peroxidase Compound Ii |
PDB | 2vcf_X | 0 | 2 | 250 | 13 | 261 | X Chain X, Structure Of Isoniazid (Inh) Bound To Cytosolic Soybean Ascorbate Peroxidase |
Metabolic Pathways | |||
---|---|---|---|
Pathway Name | Reaction | EC | Protein Name |
L-ascorbate degradation III | RXN-12440 | EC-1.11.1.11 | L-ascorbate peroxidase |
L-ascorbate degradation V | RXN-12440 | EC-1.11.1.11 | L-ascorbate peroxidase |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
CA801321 | 250 | 1 | 250 | 0 |
CK768333 | 251 | 1 | 251 | 0 |
CA799455 | 249 | 1 | 249 | 0 |
CA799273 | 248 | 1 | 248 | 0 |
BW656502 | 249 | 1 | 249 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|