Basic Information | |
---|---|
Species | Glycine max |
Cazyme ID | Glyma12g05301.1 |
Family | GH19 |
Protein Properties | Length: 115 Molecular Weight: 12612.1 Isoelectric Point: 4.7651 |
Chromosome | Chromosome/Scaffold: 12 Start: 3523291 End: 3524953 |
Description | homolog of carrot EP3-3 chitinase |
View CDS |
External Links |
---|
NCBI Taxonomy |
Plaza |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH19 | 36 | 110 | 8.8e-27 |
DIVTQEFFNSIIDQADASCAGKNFYSRDVFLNAHNSYNEFGRLGNQDDSKREVAASFAHFTHETGHFCYIEEING |
Full Sequence |
---|
Protein Sequence Length: 115 Download |
MSKLLHIRVA GFVATFVIMV MTMVPINVSA QNIGDDIVTQ EFFNSIIDQA DASCAGKNFY 60 SRDVFLNAHN SYNEFGRLGN QDDSKREVAA SFAHFTHETG HFCYIEEING AAGD* 120 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
cd00325 | chitinase_glyco_hydro_19 | 2.0e-30 | 38 | 114 | 78 | + Glycoside hydrolase family 19 chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases but they are smaller in size due to certain deletions. Despite any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the procaryotic/eucaryotic divergence. | ||
pfam00182 | Glyco_hydro_19 | 2.0e-31 | 37 | 114 | 79 | + Chitinase class I. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004568 | chitinase activity |
GO:0006032 | chitin catabolic process |
GO:0016998 | cell wall macromolecule catabolic process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ACL36992.1 | 5e-38 | 2 | 114 | 6 | 161 | class IV chitinase [Medicago sativa] |
GenBank | ACM45716.1 | 8e-37 | 36 | 114 | 73 | 151 | class IV chitinase [Pyrus pyrifolia] |
GenBank | ACU16135.1 | 0 | 1 | 114 | 1 | 114 | unknown [Glycine max] |
GenBank | ACU23323.1 | 3e-39 | 36 | 114 | 74 | 152 | unknown [Glycine max] |
EMBL | CAA40474.1 | 4e-37 | 36 | 114 | 71 | 149 | chitinase [Phaseolus vulgaris] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3hbh_A | 9e-18 | 37 | 109 | 5 | 77 | A Chain A, Crystal Structure Of A Mammalian Sialyltransferase |
PDB | 3hbe_X | 9e-18 | 37 | 109 | 5 | 77 | A Chain A, Crystal Structure Of A Mammalian Sialyltransferase |
PDB | 3hbd_A | 9e-18 | 37 | 109 | 5 | 77 | A Chain A, Class Iv Chitinase Structure From Picea Abies At 1.8a |
PDB | 1dxj_A | 0.0000001 | 37 | 99 | 5 | 68 | A Chain A, Structure Of The Chitinase From Jack Bean |
PDB | 3cql_B | 0.0000001 | 35 | 99 | 3 | 68 | A Chain A, Crystal Structure Of Gh Family 19 Chitinase From Carica Papaya |
Metabolic Pathways | |||
---|---|---|---|
Pathway Name | Reaction | EC | Protein Name |
chitin degradation II | 3.2.1.14-RXN | EC-3.2.1.14 | chitinase |
chitin degradation II | RXN-12623 | EC-3.2.1.14 | chitinase |
chitin degradation II | RXN-12624 | EC-3.2.1.14 | chitinase |
chitin degradation III (carnivorous plants) | 3.2.1.14-RXN | EC-3.2.1.14 | chitinase |