Basic Information | |
---|---|
Species | Glycine max |
Cazyme ID | Glyma12g34500.2 |
Family | AA6 |
Protein Properties | Length: 200 Molecular Weight: 21424.4 Isoelectric Point: 6.1172 |
Chromosome | Chromosome/Scaffold: 12 Start: 37683358 End: 37687651 |
Description | flavodoxin-like quinone reductase 1 |
View CDS |
External Links |
---|
NCBI Taxonomy |
Plaza |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
AA6 | 5 | 194 | 0 |
YYSMYGHVEKLAEEIKKGASSVEGVEAKLWQVPETLQDEVLGKMSAPPKSDVPVITPNELSEADGFVFGFPTRFGMMAAQFKAFLDATGGLWRAQQLAGK PAGIFYSTGSQGGGQETTALTAITQLVHHGMIFIPIGYTFGAGMFEMEKVKGGSPYGAGTYAGDGSRQPSELELQQAFHQGKYIAGITKK |
Full Sequence |
---|
Protein Sequence Length: 200 Download |
MENWYYSMYG HVEKLAEEIK KGASSVEGVE AKLWQVPETL QDEVLGKMSA PPKSDVPVIT 60 PNELSEADGF VFGFPTRFGM MAAQFKAFLD ATGGLWRAQQ LAGKPAGIFY STGSQGGGQE 120 TTALTAITQL VHHGMIFIPI GYTFGAGMFE MEKVKGGSPY GAGTYAGDGS RQPSELELQQ 180 AFHQGKYIAG ITKKLKQAA* |
Functional Domains Download unfiltered results here | ||||||
---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description |
pfam00258 | Flavodoxin_1 | 7.0e-9 | 5 | 109 | 117 | + Flavodoxin. |
pfam03358 | FMN_red | 2.0e-12 | 13 | 142 | 134 | + NADPH-dependent FMN reductase. |
COG0655 | WrbA | 3.0e-35 | 5 | 196 | 199 | + Multimeric flavodoxin WrbA [General function prediction only] |
TIGR01755 | flav_wrbA | 4.0e-60 | 5 | 195 | 192 | + NAD(P)H:quinone oxidoreductase, type IV. This model represents a protein, WrbA, related to and slightly larger than flavodoxin. It was just shown, in E. coli and Archaeoglobus fulgidus (and previously for some eukaryotic homologs) to act as fourth type of NAD(P)H:quinone oxidoreductase. In E. coli, this protein was earlier reported to be produced during stationary phase, bind to the trp repressor, and make trp operon repression more efficient. WrbA does not interact with the trp operator by itself. Members are found in species in which homologs of the E. coli trp operon repressor TrpR are not detected [Energy metabolism, Electron transport]. |
PRK03767 | PRK03767 | 9.0e-71 | 5 | 196 | 193 | + NAD(P)H:quinone oxidoreductase; Provisional |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0009055 | electron carrier activity |
GO:0010181 | FMN binding |
GO:0016491 | oxidoreductase activity |
GO:0050662 | coenzyme binding |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ACJ86051.1 | 0 | 5 | 199 | 9 | 203 | unknown [Medicago truncatula] |
GenBank | ACU13364.1 | 0 | 5 | 199 | 9 | 203 | unknown [Glycine max] |
GenBank | ACU13760.1 | 0 | 1 | 199 | 1 | 199 | unknown [Glycine max] |
GenBank | ACU13985.1 | 0 | 5 | 199 | 9 | 203 | unknown [Glycine max] |
RefSeq | XP_002283286.1 | 0 | 5 | 199 | 9 | 203 | PREDICTED: hypothetical protein [Vitis vinifera] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3b6m_B | 0 | 5 | 196 | 8 | 197 | A Chain A, Crystal Structure Of The Polygalacturonase From Colletotrichum Lupini And Its Implications For The Interaction With Polygalacturonase- Inhibiting Proteins |
PDB | 3b6m_A | 0 | 5 | 196 | 8 | 197 | A Chain A, Crystal Structure Of The Polygalacturonase From Colletotrichum Lupini And Its Implications For The Interaction With Polygalacturonase- Inhibiting Proteins |
PDB | 3b6k_B | 0 | 5 | 196 | 8 | 197 | A Chain A, Crystal Structure Of The Polygalacturonase From Colletotrichum Lupini And Its Implications For The Interaction With Polygalacturonase- Inhibiting Proteins |
PDB | 3b6k_A | 0 | 5 | 196 | 8 | 197 | A Chain A, Crystal Structure Of The Polygalacturonase From Colletotrichum Lupini And Its Implications For The Interaction With Polygalacturonase- Inhibiting Proteins |
PDB | 3b6j_B | 0 | 5 | 196 | 8 | 197 | A Chain A, Crystal Structure Of The Polygalacturonase From Colletotrichum Lupini And Its Implications For The Interaction With Polygalacturonase- Inhibiting Proteins |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
EV265400 | 200 | 1 | 200 | 0 |
FK019740 | 196 | 5 | 200 | 0 |
GR828932 | 196 | 5 | 200 | 0 |
EV280148 | 196 | 5 | 200 | 0 |
EV266518 | 196 | 5 | 200 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|
![]() |