| Basic Information | |
|---|---|
| Species | Glycine max |
| Cazyme ID | Glyma16g17075.1 |
| Family | GH1 |
| Protein Properties | Length: 169 Molecular Weight: 18919.4 Isoelectric Point: 8.5856 |
| Chromosome | Chromosome/Scaffold: 16 Start: 18342787 End: 18343908 |
| Description | beta glucosidase 17 |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| Plaza |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH1 | 1 | 168 | 4.40008e-43 |
| VLPKGKLSACANHEGVNYYNNLINKLMANALEDEYGGFLSPHIVDDFRNYAELCFKEFGNGVKHWITLNEPRSVSKNGYANGKFAPGQCSDWLKLNCTGG DSGTEPHLTWRYQLLAHATTAKLYKTKYQASQKGLIGITLNSDWYMPVSKEKSDRDAARRGLDFMFGW | |||
| Full Sequence |
|---|
| Protein Sequence Length: 169 Download |
| VLPKGKLSAC ANHEGVNYYN NLINKLMANA LEDEYGGFLS PHIVDDFRNY AELCFKEFGN 60 GVKHWITLNE PRSVSKNGYA NGKFAPGQCS DWLKLNCTGG DSGTEPHLTW RYQLLAHATT 120 AKLYKTKYQA SQKGLIGITL NSDWYMPVSK EKSDRDAARR GLDFMFGW* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| COG2723 | BglB | 2.0e-25 | 11 | 168 | 173 | + Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism] | ||
| PLN02998 | PLN02998 | 4.0e-35 | 1 | 168 | 183 | + beta-glucosidase | ||
| PLN02814 | PLN02814 | 2.0e-36 | 12 | 168 | 172 | + beta-glucosidase | ||
| pfam00232 | Glyco_hydro_1 | 1.0e-37 | 1 | 168 | 184 | + Glycosyl hydrolase family 1. | ||
| PLN02849 | PLN02849 | 3.0e-38 | 12 | 168 | 172 | + beta-glucosidase | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ABV54754.1 | 0 | 1 | 168 | 102 | 284 | beta-glucosidase-like protein [Trifolium repens] |
| GenBank | ABW76288.1 | 0 | 1 | 168 | 112 | 294 | beta-glucosidase G3 [Medicago truncatula] |
| GenBank | ACD65511.1 | 0 | 1 | 168 | 124 | 306 | beta-glucosidase D7 [Lotus japonicus] |
| Swiss-Prot | P26205 | 0 | 1 | 168 | 110 | 292 | BGLT_TRIRP RecName: Full=Cyanogenic beta-glucosidase; AltName: Full=Linamarase; Flags: Precursor |
| RefSeq | XP_002285582.1 | 0 | 1 | 168 | 118 | 300 | PREDICTED: hypothetical protein [Vitis vinifera] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 1cbg_A | 0 | 1 | 168 | 99 | 281 | A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase |
| PDB | 3ptq_B | 0 | 1 | 168 | 114 | 296 | A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase |
| PDB | 3ptq_A | 0 | 1 | 168 | 114 | 296 | A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase |
| PDB | 3ptm_B | 0 | 1 | 168 | 114 | 296 | A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase |
| PDB | 3ptm_A | 0 | 1 | 168 | 114 | 296 | A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase |
| Metabolic Pathways | |||
|---|---|---|---|
| Pathway Name | Reaction | EC | Protein Name |
| coumarin biosynthesis (via 2-coumarate) | RXN-8036 | EC-3.2.1.21 | β-glucosidase |
| linamarin degradation | RXN-5341 | EC-3.2.1.21 | β-glucosidase |
| linustatin bioactivation | RXN-13602 | EC-3.2.1.21 | β-glucosidase |
| linustatin bioactivation | RXN-5341 | EC-3.2.1.21 | β-glucosidase |
| lotaustralin degradation | RXN-9674 | EC-3.2.1.21 | β-glucosidase |
| neolinustatin bioactivation | RXN-13603 | EC-3.2.1.21 | β-glucosidase |
| neolinustatin bioactivation | RXN-9674 | EC-3.2.1.21 | β-glucosidase |
| taxiphyllin bioactivation | RXN-13600 | EC-3.2.1.21 | β-glucosidase |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| FK003057 | 183 | 1 | 168 | 0 |
| FE710071 | 183 | 1 | 168 | 0 |
| HO042476 | 173 | 11 | 168 | 0 |
| BI311485 | 183 | 1 | 168 | 0 |
| CB893105 | 183 | 1 | 168 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |