| Basic Information | |
|---|---|
| Species | Glycine max |
| Cazyme ID | Glyma16g26630.1 |
| Family | GH16 |
| Protein Properties | Length: 216 Molecular Weight: 25415.4 Isoelectric Point: 6.7687 |
| Chromosome | Chromosome/Scaffold: 16 Start: 30701119 End: 30703044 |
| Description | xyloglucan endotransglucosylase/hydrolase 5 |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| Plaza |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| GH16 | 4 | 132 | 2.8e-21 |
| KLVAGDSAGTVTAFYLSSTNSEHDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIYLWFDPTREYHRYSVLWNMYQIVFYVDDYPIRVFKNSNDLGVK FPFNQPMKIYNSLWNADDWATRGGLEKTD | |||
| Full Sequence |
|---|
| Protein Sequence Length: 216 Download |
| MYIKLVAGDS AGTVTAFYLS STNSEHDEID FEFLGNRTGQ PYILQTNVFT GGKGDREQRI 60 YLWFDPTREY HRYSVLWNMY QIVFYVDDYP IRVFKNSNDL GVKFPFNQPM KIYNSLWNAD 120 DWATRGGLEK TDWSKAPFIA SYKGFHIDGC EASVNAKFCD TQGKRWWDQP EFRDLDAAQW 180 QKLSWVRQKY TIYNYCADRK RYPQVSPECA RDRDI* 240 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam06955 | XET_C | 1.0e-19 | 159 | 209 | 52 | + Xyloglucan endo-transglycosylase (XET) C-terminus. This family represents the C-terminus (approximately 60 residues) of plant xyloglucan endo-transglycosylase (XET). Xyloglucan is the predominant hemicellulose in the cell walls of most dicotyledons. With cellulose, it forms a network that strengthens the cell wall. XET catalyzes the splitting of xyloglucan chains and the linking of the newly generated reducing end to the non-reducing end of another xyloglucan chain, thereby loosening the cell wall. Note that all family members contain the pfam00722 domain. | ||
| cd02183 | GH16_fungal_CRH1_transglycosylase | 5.0e-23 | 3 | 143 | 156 | + glycosylphosphatidylinositol-glucanosyltransferase. Group of fungal GH16 members related to Saccharomyces cerevisiae Crh1p. Chr1p and Crh2p are transglycosylases that are required for the linkage of chitin to beta(1-3)glucose branches of beta(1-6)glucan, an important step in the assembly of new cell wall. Both have been shown to be glycosylphosphatidylinositol (GPI)-anchored. A third homologous protein, Crr1p, functions in the formation of the spore wall. They belongs to the family 16 of glycosyl hydrolases that includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues. | ||
| pfam00722 | Glyco_hydro_16 | 7.0e-56 | 7 | 135 | 131 | + Glycosyl hydrolases family 16. | ||
| PLN03161 | PLN03161 | 5.0e-87 | 1 | 211 | 215 | + Probable xyloglucan endotransglucosylase/hydrolase protein; Provisional | ||
| cd02176 | GH16_XET | 4.0e-133 | 1 | 209 | 211 | + Xyloglucan endotransglycosylase, member of glycosyl hydrolase family 16. Xyloglucan endotransglycosylases (XETs) cleave and religate xyloglucan polymers in plant cell walls via a transglycosylation mechanism. Xyloglucan is a soluble hemicellulose with a backbone of beta-1,4-linked glucose units, partially substituted with alpha-1,6-linked xylopyranose branches. It binds noncovalently to cellulose, cross-linking the adjacent cellulose microfibrils, giving it a key structural role as a matrix polymer. Therefore, XET plays an important role in all plant processes that require cell wall remodeling. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005618 | cell wall |
| GO:0005975 | carbohydrate metabolic process |
| GO:0006073 | cellular glucan metabolic process |
| GO:0016762 | xyloglucan:xyloglucosyl transferase activity |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ACU20337.1 | 0 | 1 | 215 | 78 | 292 | unknown [Glycine max] |
| GenBank | ACU23972.1 | 0 | 1 | 215 | 81 | 296 | unknown [Glycine max] |
| EMBL | CAA06217.1 | 0 | 1 | 215 | 81 | 295 | xyloglucan endotransglucosylase/hydrolase [Cicer arietinum] |
| Swiss-Prot | Q39857 | 0 | 1 | 215 | 80 | 295 | XTH_SOYBN RecName: Full=Probable xyloglucan endotransglucosylase/hydrolase; Flags: Precursor |
| Swiss-Prot | Q41638 | 0 | 1 | 215 | 78 | 292 | XTHA_PHAAN RecName: Full=Xyloglucan endotransglucosylase/hydrolase protein A; AltName: Full=VaXTH1; Flags: Precursor |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 1un1_B | 0 | 1 | 215 | 64 | 278 | A Chain A, Structure Of Glycogen Synthase From Pyrococcus Abyssi |
| PDB | 1un1_A | 0 | 1 | 215 | 64 | 278 | A Chain A, Structure Of Glycogen Synthase From Pyrococcus Abyssi |
| PDB | 1umz_B | 0 | 1 | 215 | 64 | 278 | A Chain A, Xyloglucan Endotransglycosylase In Complex With The Xyloglucan Nonasaccharide Xllg. |
| PDB | 1umz_A | 0 | 1 | 215 | 64 | 278 | A Chain A, Xyloglucan Endotransglycosylase In Complex With The Xyloglucan Nonasaccharide Xllg. |
| PDB | 2uwb_B | 0 | 3 | 209 | 67 | 267 | A Chain A, Crystal Structure Of The Nasturtium Seedling Mutant Xyloglucanase Isoform Nxg1-Delta-Yniig |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
| Hit | Length | Start | End | EValue |
| BG838525 | 216 | 1 | 216 | 0 |
| HO784912 | 216 | 1 | 216 | 0 |
| FG841847 | 216 | 1 | 216 | 0 |
| FC458182 | 216 | 1 | 216 | 0 |
| CA799025 | 208 | 1 | 208 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
