| Basic Information | |
|---|---|
| Species | Glycine max |
| Cazyme ID | Glyma17g37980.2 |
| Family | AA2 |
| Protein Properties | Length: 171 Molecular Weight: 18244.2 Isoelectric Point: 7.8589 |
| Chromosome | Chromosome/Scaffold: 17 Start: 41716206 End: 41716951 |
| Description | Peroxidase superfamily protein |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| Plaza |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| AA2 | 80 | 162 | 1e-23 |
| NDRTVPAALLRMHFHDCFIRGCDASVLLESKGKNKAEKDGPPNISLHAFYVIDNAKKAVEAVFPGIVSCADILALAARDAVAL | |||
| Full Sequence |
|---|
| Protein Sequence Length: 171 Download |
| MLNNHTLVTT PSFPCHRLVS TNTILVNVNR NMAAIATVIM LITMSLASLV SALNVNYYEN 60 TCPHNVDSIV AAAVHKATMN DRTVPAALLR MHFHDCFIRG CDASVLLESK GKNKAEKDGP 120 PNISLHAFYV IDNAKKAVEA VFPGIVSCAD ILALAARDAV ALVSVSNNCI * 180 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam00141 | peroxidase | 8.0e-26 | 70 | 148 | 80 | + Peroxidase. | ||
| PLN03030 | PLN03030 | 7.0e-26 | 32 | 148 | 119 | + cationic peroxidase; Provisional | ||
| cd00693 | secretory_peroxidase | 7.0e-48 | 53 | 148 | 96 | + Horseradish peroxidase and related secretory plant peroxidases. Secretory peroxidases belong to class III of the plant heme-dependent peroxidase superfamily. All members of the superfamily share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Class III peroxidases are found in the extracellular space or in the vacuole in plants where they have been implicated in hydrogen peroxide detoxification, auxin catabolism and lignin biosynthesis, and stress response. Class III peroxidases contain four conserved disulphide bridges and two conserved calcium binding sites. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004601 | peroxidase activity |
| GO:0006979 | response to oxidative stress |
| GO:0020037 | heme binding |
| GO:0055114 | oxidation-reduction process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ABK95626.1 | 0 | 32 | 162 | 1 | 132 | unknown [Populus trichocarpa] |
| GenBank | ACU20287.1 | 0 | 32 | 162 | 1 | 130 | unknown [Glycine max] |
| RefSeq | XP_002285892.1 | 0 | 38 | 162 | 8 | 131 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002300689.1 | 0 | 33 | 162 | 3 | 132 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002327640.1 | 0 | 32 | 162 | 1 | 132 | predicted protein [Populus trichocarpa] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 1qo4_A | 1e-30 | 53 | 162 | 3 | 112 | A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase |
| PDB | 1pa2_A | 1e-30 | 53 | 162 | 3 | 112 | A Chain A, Arabidopsis Thaliana Peroxidase A2 |
| PDB | 1sch_B | 2e-28 | 53 | 170 | 2 | 120 | A Chain A, Peanut Peroxidase |
| PDB | 1sch_A | 2e-28 | 53 | 170 | 2 | 120 | A Chain A, Peanut Peroxidase |
| PDB | 3hdl_A | 3e-28 | 53 | 162 | 2 | 111 | A Chain A, Crystal Structure Of Highly Glycosylated Peroxidase From Royal Palm Tree |
| Metabolic Pathways | |||
|---|---|---|---|
| Pathway Name | Reaction | EC | Protein Name |
| betanidin degradation | RXN-8635 | EC-1.11.1.7 | peroxidase |
| Transmembrane Domains | |||||
|---|---|---|---|---|---|
| Start | End | ||||
| 33 | 55 | ||||
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
| Hit | Length | Start | End | EValue |
| EV275845 | 126 | 23 | 148 | 0 |
| FF389169 | 119 | 31 | 148 | 0 |
| FQ370922 | 118 | 31 | 148 | 0 |
| FQ369122 | 118 | 31 | 148 | 0 |
| FQ366763 | 118 | 31 | 148 | 0 |
| Orthologous Group | |||||
|---|---|---|---|---|---|
| Species | ID | ||||
| Picea abies | MA_10296946g0020 | MA_652560g0010 | |||
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |