| Basic Information | |
|---|---|
| Species | Picea abies |
| Cazyme ID | MA_10296946g0020 |
| Family | AA2 |
| Protein Properties | Length: 121 Molecular Weight: 13419.4 Isoelectric Point: 8.223 |
| View CDS | |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| AA2 | 1 | 84 | 2e-21 |
| MHFHDCFIRGCDTSVLLDSTTSPKNEAEKNALPNISLHALYVIDNAKTKIESICPKTVSYTDILAIAARDVLLLAGGPQWDILK | |||
| Full Sequence |
|---|
| Protein Sequence Length: 121 Download |
| MHFHDCFIRG CDTSVLLDST TSPKNEAEKN ALPNISLHAL YVIDNAKTKI ESICPKTVSY 60 TDILAIAARD VLLLAGGPQW DILKERAGSS MNIGCHNWKT KEFRGTISPF AVCTRSQKEP 120 R |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN03030 | PLN03030 | 8.0e-27 | 1 | 82 | 82 | + cationic peroxidase; Provisional | ||
| pfam00141 | peroxidase | 1.0e-29 | 1 | 83 | 84 | + Peroxidase. | ||
| cd00693 | secretory_peroxidase | 3.0e-41 | 1 | 86 | 86 | + Horseradish peroxidase and related secretory plant peroxidases. Secretory peroxidases belong to class III of the plant heme-dependent peroxidase superfamily. All members of the superfamily share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Class III peroxidases are found in the extracellular space or in the vacuole in plants where they have been implicated in hydrogen peroxide detoxification, auxin catabolism and lignin biosynthesis, and stress response. Class III peroxidases contain four conserved disulphide bridges and two conserved calcium binding sites. | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ABE66389.1 | 3e-31 | 1 | 86 | 62 | 145 | peroxidase [Striga asiatica] |
| GenBank | ACU20287.1 | 2e-31 | 1 | 86 | 59 | 142 | unknown [Glycine max] |
| RefSeq | XP_002510587.1 | 4e-31 | 1 | 86 | 60 | 143 | Peroxidase 64 precursor, putative [Ricinus communis] |
| RefSeq | XP_002510864.1 | 4e-31 | 1 | 86 | 65 | 148 | Peroxidase 66 precursor, putative [Ricinus communis] |
| RefSeq | XP_002531135.1 | 2e-31 | 1 | 86 | 61 | 144 | Peroxidase 64 precursor, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 1qo4_A | 3e-23 | 1 | 86 | 40 | 124 | A Chain A, Raphanus Sativus Anionic Peroxidase. |
| PDB | 1pa2_A | 3e-23 | 1 | 86 | 40 | 124 | A Chain A, Arabidopsis Thaliana Peroxidase A2 |
| PDB | 3hdl_A | 4e-23 | 1 | 86 | 39 | 123 | A Chain A, Crystal Structure Of Highly Glycosylated Peroxidase From Royal Palm Tree |
| PDB | 1sch_B | 1e-22 | 1 | 90 | 39 | 127 | A Chain A, Peanut Peroxidase |
| PDB | 1sch_A | 1e-22 | 1 | 90 | 39 | 127 | A Chain A, Peanut Peroxidase |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| DR464782 | 86 | 1 | 86 | 5.60519e-45 |
| EX437644 | 86 | 1 | 86 | 4.06377e-44 |
| EX437774 | 86 | 1 | 86 | 6e-36 |
| DY977579 | 86 | 1 | 86 | 2e-34 |
| EL404263 | 86 | 1 | 86 | 3e-34 |
| Orthologous Group | |||||
|---|---|---|---|---|---|
| Species | ID | ||||
| Glycine max | Glyma17g37980.2 | ||||
| Picea abies | MA_652560g0010 | ||||
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |