| Basic Information | |
|---|---|
| Species | Picea abies |
| Cazyme ID | MA_652560g0010 |
| Family | AA2 |
| Protein Properties | Length: 120 Molecular Weight: 13213.2 Isoelectric Point: 7.3417 |
| View CDS | |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| AA2 | 1 | 83 | 8.9e-23 |
| MHFHDCFIRGCDASVLLDSTTSPKNEVEKNALPNISLRALYVIDNAKTKIESICPKTVSYTDILAIAARDVVLLAGGPQWDVL | |||
| Full Sequence |
|---|
| Protein Sequence Length: 120 Download |
| MHFHDCFIRG CDASVLLDST TSPKNEVEKN ALPNISLRAL YVIDNAKTKI ESICPKTVSY 60 TDILAIAARD VVLLAGGPQW DVLKEQAGSS MNIGCHNWKT KEFIGTISPF AMCTRSQKEP 120 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN03030 | PLN03030 | 2.0e-29 | 1 | 82 | 82 | + cationic peroxidase; Provisional | ||
| pfam00141 | peroxidase | 2.0e-32 | 1 | 83 | 84 | + Peroxidase. | ||
| cd00693 | secretory_peroxidase | 2.0e-45 | 1 | 83 | 83 | + Horseradish peroxidase and related secretory plant peroxidases. Secretory peroxidases belong to class III of the plant heme-dependent peroxidase superfamily. All members of the superfamily share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Class III peroxidases are found in the extracellular space or in the vacuole in plants where they have been implicated in hydrogen peroxide detoxification, auxin catabolism and lignin biosynthesis, and stress response. Class III peroxidases contain four conserved disulphide bridges and two conserved calcium binding sites. | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ACU20287.1 | 2e-30 | 1 | 84 | 59 | 140 | unknown [Glycine max] |
| DDBJ | BAD93164.1 | 1e-30 | 1 | 114 | 63 | 168 | cationic peroxidase [Zinnia elegans] |
| EMBL | CAA76376.1 | 2e-31 | 1 | 84 | 23 | 104 | peroxidase [Spinacia oleracea] |
| RefSeq | NP_200002.3 | 2e-31 | 1 | 84 | 63 | 144 | peroxidase [Arabidopsis thaliana] |
| RefSeq | XP_002510864.1 | 5e-32 | 1 | 84 | 65 | 146 | Peroxidase 66 precursor, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 1qo4_A | 1e-24 | 1 | 83 | 40 | 121 | A Chain A, Crystal Structure Of The Nasturtium Seedling Mutant Xyloglucanase Isoform Nxg1-Delta-Yniig |
| PDB | 1pa2_A | 1e-24 | 1 | 83 | 40 | 121 | A Chain A, Arabidopsis Thaliana Peroxidase A2 |
| PDB | 3hdl_A | 3e-24 | 1 | 82 | 39 | 119 | A Chain A, Crystal Structure Of Highly Glycosylated Peroxidase From Royal Palm Tree |
| PDB | 1sch_B | 4e-24 | 1 | 83 | 39 | 120 | A Chain A, Peanut Peroxidase |
| PDB | 1sch_A | 4e-24 | 1 | 83 | 39 | 120 | A Chain A, Peanut Peroxidase |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| DR464782 | 86 | 1 | 86 | 0 |
| EX437644 | 84 | 1 | 84 | 2.8026e-45 |
| EX437774 | 122 | 1 | 115 | 2e-37 |
| EX771754 | 92 | 1 | 92 | 6e-35 |
| EX763034 | 92 | 1 | 92 | 1e-34 |
| Orthologous Group | |||||
|---|---|---|---|---|---|
| Species | ID | ||||
| Glycine max | Glyma17g37980.2 | ||||
| Picea abies | MA_10296946g0020 | ||||
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |