Basic Information | |
---|---|
Species | Glycine max |
Cazyme ID | Glyma19g02750.2 |
Family | AA6 |
Protein Properties | Length: 137 Molecular Weight: 14565.8 Isoelectric Point: 5.5695 |
Chromosome | Chromosome/Scaffold: 19 Start: 2684129 End: 2684767 |
Description | flavodoxin-like quinone reductase 1 |
View CDS |
External Links |
---|
NCBI Taxonomy |
Plaza |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
AA6 | 1 | 135 | 0 |
MYEHVEKLADEIKKGVASIEGVEAKLWQPETLPQEVLGKMGAPPKTDVPIMTPNELPEADGLLLGFPTRFGLMAAQFKAFLDATRGLWCTHALAGKPAGI FYSTGSEGGGQQTTPLTSITQLVHHGMIFVPIGYS |
Full Sequence |
---|
Protein Sequence Length: 137 Download |
MYEHVEKLAD EIKKGVASIE GVEAKLWQPE TLPQEVLGKM GAPPKTDVPI MTPNELPEAD 60 GLLLGFPTRF GLMAAQFKAF LDATRGLWCT HALAGKPAGI FYSTGSEGGG QQTTPLTSIT 120 QLVHHGMIFV PIGYSA* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam03358 | FMN_red | 4.0e-7 | 58 | 136 | 80 | + NADPH-dependent FMN reductase. | ||
COG0655 | WrbA | 7.0e-19 | 1 | 134 | 142 | + Multimeric flavodoxin WrbA [General function prediction only] | ||
TIGR01755 | flav_wrbA | 6.0e-35 | 1 | 136 | 137 | + NAD(P)H:quinone oxidoreductase, type IV. This model represents a protein, WrbA, related to and slightly larger than flavodoxin. It was just shown, in E. coli and Archaeoglobus fulgidus (and previously for some eukaryotic homologs) to act as fourth type of NAD(P)H:quinone oxidoreductase. In E. coli, this protein was earlier reported to be produced during stationary phase, bind to the trp repressor, and make trp operon repression more efficient. WrbA does not interact with the trp operator by itself. Members are found in species in which homologs of the E. coli trp operon repressor TrpR are not detected [Energy metabolism, Electron transport]. | ||
PRK03767 | PRK03767 | 3.0e-38 | 1 | 136 | 137 | + NAD(P)H:quinone oxidoreductase; Provisional |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ACU13157.1 | 0 | 2 | 135 | 14 | 148 | unknown [Glycine max] |
GenBank | ACU19740.1 | 0 | 1 | 135 | 15 | 150 | unknown [Glycine max] |
EMBL | CAD31838.1 | 0 | 2 | 135 | 14 | 148 | putative quinone oxidoreductase [Cicer arietinum] |
RefSeq | XP_002518592.1 | 0 | 2 | 135 | 13 | 147 | Flavoprotein wrbA, putative [Ricinus communis] |
RefSeq | XP_002534445.1 | 0 | 1 | 135 | 12 | 147 | Minor allergen Alt a, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 4dy4_C | 1e-34 | 1 | 136 | 10 | 144 | A Chain A, High Resolution Structure Of E.coli Wrba With Fmn |
PDB | 4dy4_A | 1e-34 | 1 | 136 | 10 | 144 | A Chain A, High Resolution Structure Of E.coli Wrba With Fmn |
PDB | 3b6m_B | 1e-34 | 1 | 136 | 11 | 145 | A Chain A, High Resolution Structure Of E.coli Wrba With Fmn |
PDB | 3b6m_A | 1e-34 | 1 | 136 | 11 | 145 | A Chain A, High Resolution Structure Of E.coli Wrba With Fmn |
PDB | 3b6k_B | 1e-34 | 1 | 136 | 11 | 145 | A Chain A, High Resolution Structure Of E.coli Wrba With Fmn |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
BG045535 | 136 | 1 | 135 | 0 |
EV268886 | 136 | 1 | 135 | 0 |
BE020453 | 136 | 1 | 135 | 0 |
GW965263 | 136 | 1 | 135 | 0 |
ES719573 | 136 | 1 | 135 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|