y
Basic Information | |
---|---|
Species | Glycine max |
Cazyme ID | Glyma19g44401.1 |
Family | GH18 |
Protein Properties | Length: 176 Molecular Weight: 20032 Isoelectric Point: 8.9195 |
Chromosome | Chromosome/Scaffold: 19 Start: 49846690 End: 49847847 |
Description | Glycosyl hydrolase superfamily protein |
View CDS |
External Links |
---|
NCBI Taxonomy |
Plaza |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH18 | 31 | 166 | 5.9e-22 |
FFSLMTYDFSNPHNPGPNAPMKWIQIVLQLLLGTSANRTQSLAPKILLGIDFYGNDFSLSRDAGGGAIIGRDYLALLEKHRPELQWDKNSGEHFFFYTDN KDIRHAVFYPSSKSISLRSEEARSRGCGISIWEIGQ |
Full Sequence |
---|
Protein Sequence Length: 176 Download |
MLTILSRSML ATTSDYKPKL FFVDIFLLRK FFSLMTYDFS NPHNPGPNAP MKWIQIVLQL 60 LLGTSANRTQ SLAPKILLGI DFYGNDFSLS RDAGGGAIIG RDYLALLEKH RPELQWDKNS 120 GEHFFFYTDN KDIRHAVFYP SSKSISLRSE EARSRGCGIS IWEIGQGLDY FFYLL* 180 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam00704 | Glyco_hydro_18 | 2.0e-6 | 31 | 166 | 162 | + Glycosyl hydrolases family 18. | ||
smart00636 | Glyco_18 | 8.0e-14 | 31 | 166 | 159 | + Glyco_18 domain. | ||
COG3858 | COG3858 | 2.0e-19 | 31 | 175 | 150 | + Predicted glycosyl hydrolase [General function prediction only] | ||
cd02874 | GH18_CFLE_spore_hydrolase | 2.0e-21 | 31 | 166 | 141 | + Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis. | ||
cd02876 | GH18_SI-CLP | 1.0e-65 | 31 | 175 | 145 | + Stabilin-1 interacting chitinase-like protein (SI-CLP) is a eukaryotic chitinase-like protein of unknown function that interacts with the endocytic/sorting transmembrane receptor stabilin-1 and is secreted from the lysosome. SI-CLP has a glycosyl hydrolase family 18 (GH18) domain but lacks a chitin-binding domain. The catalytic amino acids of the GH18 domain are not conserved in SI-CLP, similar to the chitolectins YKL-39, YKL-40, and YM1/2. Human SI-CLP is sorted to late endosomes and secretory lysosomes in alternatively activated macrophages. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
GO:0005975 | carbohydrate metabolic process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ACU17227.1 | 0 | 60 | 175 | 1 | 118 | unknown [Glycine max] |
EMBL | CBI40499.1 | 0 | 32 | 175 | 292 | 435 | unnamed protein product [Vitis vinifera] |
RefSeq | NP_192013.1 | 0 | 32 | 175 | 286 | 430 | glycosyl hydrolase family 18 protein [Arabidopsis thaliana] |
RefSeq | XP_002320856.1 | 0 | 32 | 175 | 257 | 399 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002523373.1 | 0 | 32 | 175 | 289 | 432 | chitinase, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3bxw_A | 5.04467e-44 | 32 | 175 | 256 | 393 | B Chain B, Crystal Structure Of Stabilin-1 Interacting Chitinase-Like Protein, Si-Clp |
PDB | 3bxw_B | 5.04467e-44 | 32 | 175 | 256 | 393 | B Chain B, Crystal Structure Of Stabilin-1 Interacting Chitinase-Like Protein, Si-Clp |
PDB | 3cz8_B | 0.00000005 | 4 | 164 | 147 | 308 | A Chain A, Crystal Structure Of Putative Sporulation-Specific Glycosylase Ydhd From Bacillus Subtilis |
PDB | 3cz8_A | 0.00000005 | 4 | 164 | 147 | 308 | A Chain A, Crystal Structure Of Putative Sporulation-Specific Glycosylase Ydhd From Bacillus Subtilis |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
BE822540 | 147 | 32 | 176 | 0 |
BE823909 | 147 | 32 | 176 | 0 |
FG931310 | 146 | 32 | 176 | 0 |
CU527825 | 145 | 32 | 176 | 0 |
DW516537 | 146 | 32 | 176 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|