Basic Information | |
---|---|
Species | Glycine max |
Cazyme ID | Glyma20g20260.1 |
Family | GT24 |
Protein Properties | Length: 134 Molecular Weight: 15463.4 Isoelectric Point: 4.4596 |
Chromosome | Chromosome/Scaffold: 20 Start: 28732575 End: 28733567 |
Description | UDP-glucose:glycoprotein glucosyltransferases;transferases, transferring hexosyl groups;transferases, transferring glycosyl groups |
View CDS |
External Links |
---|
NCBI Taxonomy |
Plaza |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GT24 | 27 | 78 | 5.2e-28 |
FFDLPNYAQHTVPIFSLPQEWIWCESWCGNATKYKAKTIDLCNNPMTKEPKL |
Full Sequence |
---|
Protein Sequence Length: 134 Download |
KEIHERPVDG IRIPIYFPLT FCLLNAFFDL PNYAQHTVPI FSLPQEWIWC ESWCGNATKY 60 KAKTIDLCNN PMTKEPKLRI VSEWPDLDFE ARRFTARILG DDQESESIQP PNQSKDLNSE 120 GSSNEDMESR VEL* |
Functional Domains Download unfiltered results here | ||||||
---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description |
cd00505 | Glyco_transf_8 | 0.0001 | 23 | 78 | 62 | + Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+. |
cd06432 | GT8_HUGT1_C_like | 6.0e-31 | 29 | 78 | 50 | + The C-terminal domain of HUGT1-like is highly homologous to the GT 8 family. C-terminal domain of glycoprotein glucosyltransferase (UGT). UGT is a large glycoprotein whose C-terminus contains the catalytic activity. This catalytic C-terminal domain is highly homologous to Glycosyltransferase Family 8 (GT 8) and contains the DXD motif that coordinates donor sugar binding, characteristic for Family 8 glycosyltransferases. GT 8 proteins are retaining enzymes based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. The non-catalytic N-terminal portion of the human UTG1 (HUGT1) has been shown to monitor the protein folding status and activate its glucosyltransferase activity. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0003980 | UDP-glucose:glycoprotein glucosyltransferase activity |
GO:0006486 | protein glycosylation |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | AAG51883.1 | 4.99997e-41 | 27 | 133 | 1558 | 1674 | AC016162_4 putative UDP-glucose:glycoprotein glucosyltransferase; 101200-91134 [Arabidopsis thaliana] |
EMBL | CBI23772.1 | 7.00005e-41 | 29 | 133 | 1606 | 1715 | unnamed protein product [Vitis vinifera] |
RefSeq | NP_001047660.1 | 4.00001e-41 | 29 | 127 | 139 | 242 | Os02g0664200 [Oryza sativa (japonica cultivar-group)] |
RefSeq | NP_177278.3 | 9.99995e-41 | 29 | 133 | 1499 | 1613 | EBS1 (EMS-mutagenized bri1 suppressor 1); UDP-glucose:glycoprotein glucosyltransferase/ transferase, transferring glycosyl groups / transferase, transferring hexosyl groups [Arabidopsis thaliana] |
RefSeq | XP_002268972.1 | 7.00005e-41 | 29 | 133 | 1502 | 1611 | PREDICTED: similar to EBS1 (EMS-MUTAGENIZED BRI1 SUPPRESSOR 1); UDP-glucose:glycoprotein glucosyltransferase/ transferase, transferring glycosyl groups / transferase, transferring hexosyl groups [Vitis vinifera] |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
AW472251 | 116 | 23 | 134 | 0 |
BM178108 | 125 | 9 | 126 | 0 |
BI427636 | 116 | 23 | 134 | 0 |
GR403235 | 116 | 23 | 134 | 0 |
GR402289 | 116 | 23 | 134 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|
![]() |