CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.001G039200.1
FamilyAA2
Protein PropertiesLength: 342 Molecular Weight: 36936.8 Isoelectric Point: 4.6611
ChromosomeChromosome/Scaffold: 01 Start: 3653739 End: 3655335
DescriptionPeroxidase superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA2703250
  SDPTIPGKLLRLLFHDCFVEGCDASVLLQGNGTERSDPANTSLGGFSVIDSAKSVLEIFCPETVSCADIVALAARDAVVTAGGPAFEIPTGRRDGRISDA
  ANVRSNIVDTSFTMIEMIRLFNSKGLSLDDLVTLSGAHTIGVAHCNAFSDRFQMDSKGNLTLIDTSLDNTYAKELMKKCPSGSSASKTVNNDPETSFAFD
  NQYYINLLGHKGLFQSDSVLVEDERTSARVEAFANDQETFFQSWRDSFLKLTTIGV
Full Sequence
Protein Sequence     Length: 342     Download
MQFMLTIRAS MEMKITVSCP TPNRCTLLIL VLFSFAASPL HASLSINFYA SSCPTAELIV    60
SNMVRSASSS DPTIPGKLLR LLFHDCFVEG CDASVLLQGN GTERSDPANT SLGGFSVIDS    120
AKSVLEIFCP ETVSCADIVA LAARDAVVTA GGPAFEIPTG RRDGRISDAA NVRSNIVDTS    180
FTMIEMIRLF NSKGLSLDDL VTLSGAHTIG VAHCNAFSDR FQMDSKGNLT LIDTSLDNTY    240
AKELMKKCPS GSSASKTVNN DPETSFAFDN QYYINLLGHK GLFQSDSVLV EDERTSARVE    300
AFANDQETFF QSWRDSFLKL TTIGVKTDDE GEIRQSCSFA N* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00141peroxidase0.000127430532+
cd00314plant_peroxidase_like5.0e-2360321279+
pfam00141peroxidase1.0e-5560209151+
PLN03030PLN030304.0e-7424341325+
cd00693secretory_peroxidase9.0e-14944339299+
Gene Ontology
GO TermDescription
GO:0004601peroxidase activity
GO:0006979response to oxidative stress
GO:0020037heme binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACJ11760.10113411332class III peroxidase [Gossypium hirsutum]
RefSeqXP_002285587.10113411328PREDICTED: hypothetical protein isoform 1 [Vitis vinifera]
RefSeqXP_002309694.102234112331predicted protein [Populus trichocarpa]
RefSeqXP_002324930.102233912331predicted protein [Populus trichocarpa]
RefSeqXP_002515390.1042341457759RNA lariat debranching enzyme, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3hdl_A0443412303A Chain A, Crystal Structure Of Highly Glycosylated Peroxidase From Royal Palm Tree
PDB1sch_B0443412294A Chain A, Peanut Peroxidase
PDB1sch_A0443412294A Chain A, Peanut Peroxidase
PDB1bgp_A0363411305A Chain A, Crystal Structure Of Barley Grain Peroxidase 1
PDB1qo4_A0443413304A Chain A, Crystal Structure Of Barley Grain Peroxidase 1
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
ES842506320203380
GR71089825852610
ES8053252431013420
CV245011259833410
FQ462171285112950
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_016_00365.1
Arabidopsis lyrata328551481340
Arabidopsis thalianaAT4G31760.1AT2G24800.1
Brachypodium distachyonBradi5g14650.1
Brassica rapaBra007831
Capsella rubellaCarubv10006533mCarubv10025481m
Citrus clementinaCiclev10008792m
Citrus sinensisorange1.1g019972m
Cucumis sativusCucsa.271330.1
Eucalyptus grandisEucgr.C04029.1
Fragaria vescamrna14987.1-v1.0-hybrid
Glycine maxGlyma17g33730.2Glyma14g12170.1Glyma06g06350.1
Gossypium raimondiiGorai.009G064700.2Gorai.009G064700.1Gorai.001G039200.2
Linum usitatissimumLus10026903Lus10020097
Malus domesticaMDP0000289293
Manihot esculentacassava4.1_011556m
Medicago truncatulaMedtr3g105790.1
Mimulus guttatusmgv1a021862m
Panicum virgatumPavirv00013823mPavirv00002787m
Phaseolus vulgarisPhvul.009G085800.1Phvul.001G043100.2Phvul.001G043100.1
Populus trichocarpaPotri.018G015500.1Potri.006G267400.1
Prunus persicappa025451m
Ricinus communis29848.m004502
Setaria italicaSi011734m
Selaginella moellendorffii106106
Sorghum bicolorSb06g021550.1
Thellungiella halophilaThhalv10025685mThhalv10000495m
Vitis viniferaGSVIVT01036009001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny