| Basic Information | |
|---|---|
| Species | Gossypium raimondii |
| Cazyme ID | Gorai.002G044300.2 |
| Family | CBM43 |
| Protein Properties | Length: 93 Molecular Weight: 10221.7 Isoelectric Point: 8.0308 |
| Chromosome | Chromosome/Scaffold: 02 Start: 3658746 End: 3659719 |
| Description | Carbohydrate-binding X8 domain superfamily protein |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| CBM43 | 9 | 89 | 1.8e-30 |
| WCVAKPSSDQATLLANINFACSQVDCRVMQKGCPCFSPDNLMNHASIAMNLYYQAKGRNKWNCDFRGSGLVVITNPSYADC | |||
| Full Sequence |
|---|
| Protein Sequence Length: 93 Download |
| MMVNGQKSWC VAKPSSDQAT LLANINFACS QVDCRVMQKG CPCFSPDNLM NHASIAMNLY 60 YQAKGRNKWN CDFRGSGLVV ITNPSYADCI YD* |
| Functional Domains Download unfiltered results here | ||||||
|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description |
| pfam07983 | X8 | 4.0e-15 | 8 | 77 | 76 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. |
| smart00768 | X8 | 2.0e-31 | 8 | 91 | 85 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ACJ86001.1 | 0 | 1 | 91 | 22 | 112 | unknown [Medicago truncatula] |
| RefSeq | XP_002285661.1 | 0 | 2 | 91 | 24 | 113 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002300444.1 | 0 | 1 | 91 | 24 | 114 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002332529.1 | 0 | 1 | 91 | 29 | 119 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002528491.1 | 0 | 6 | 91 | 31 | 116 | hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2jon_A | 2e-24 | 8 | 91 | 12 | 96 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
| Hit | Length | Start | End | EValue |
| DW505352 | 93 | 1 | 93 | 0 |
| CU573702 | 93 | 1 | 93 | 0 |
| CU494024 | 93 | 1 | 93 | 0 |
| CU476643 | 93 | 1 | 93 | 0 |
| GW697696 | 91 | 1 | 91 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
