y
Basic Information | |
---|---|
Species | Gossypium raimondii |
Cazyme ID | Gorai.002G044300.2 |
Family | CBM43 |
Protein Properties | Length: 93 Molecular Weight: 10221.7 Isoelectric Point: 8.0308 |
Chromosome | Chromosome/Scaffold: 02 Start: 3658746 End: 3659719 |
Description | Carbohydrate-binding X8 domain superfamily protein |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 9 | 89 | 1.8e-30 |
WCVAKPSSDQATLLANINFACSQVDCRVMQKGCPCFSPDNLMNHASIAMNLYYQAKGRNKWNCDFRGSGLVVITNPSYADC |
Full Sequence |
---|
Protein Sequence Length: 93 Download |
MMVNGQKSWC VAKPSSDQAT LLANINFACS QVDCRVMQKG CPCFSPDNLM NHASIAMNLY 60 YQAKGRNKWN CDFRGSGLVV ITNPSYADCI YD* 120 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 4.0e-15 | 8 | 77 | 76 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 2.0e-31 | 8 | 91 | 85 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ACJ86001.1 | 0 | 1 | 91 | 22 | 112 | unknown [Medicago truncatula] |
RefSeq | XP_002285661.1 | 0 | 2 | 91 | 24 | 113 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002300444.1 | 0 | 1 | 91 | 24 | 114 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002332529.1 | 0 | 1 | 91 | 29 | 119 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002528491.1 | 0 | 6 | 91 | 31 | 116 | hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 2e-24 | 8 | 91 | 12 | 96 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
DW505352 | 93 | 1 | 93 | 0 |
CU573702 | 93 | 1 | 93 | 0 |
CU494024 | 93 | 1 | 93 | 0 |
CU476643 | 93 | 1 | 93 | 0 |
GW697696 | 91 | 1 | 91 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|
![]() |