Basic Information | |
---|---|
Species | Gossypium raimondii |
Cazyme ID | Gorai.002G116900.2 |
Family | GT2 |
Protein Properties | Length: 224 Molecular Weight: 24869 Isoelectric Point: 9.8866 |
Chromosome | Chromosome/Scaffold: 02 Start: 16589082 End: 16591557 |
Description | Nucleotide-diphospho-sugar transferases superfamily protein |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GT2 | 9 | 166 | 1.60028e-42 |
SIIVPTYNERLNIALIVYLIFKHLRDVDFEIIVVDDGSPDGTQEVVKKLQTLYGEDRILLRPRPKKLGLGTAYIHGLKHASGNFVVIMDADLSHHPKYLP SFIKKQLETGASIVTGTRYVKGGGVHGWNLIRKLTSRGANVLAQTLLWPGVSDLTGSF |
Full Sequence |
---|
Protein Sequence Length: 224 Download |
MDAAKNKYSI IVPTYNERLN IALIVYLIFK HLRDVDFEII VVDDGSPDGT QEVVKKLQTL 60 YGEDRILLRP RPKKLGLGTA YIHGLKHASG NFVVIMDADL SHHPKYLPSF IKKQLETGAS 120 IVTGTRYVKG GGVHGWNLIR KLTSRGANVL AQTLLWPGVS DLTGSFSKGY VFQMEMIVRA 180 SRKGYHIEEV PITFVDRVFG SSKLGGSEIV EYLKGLVYLL MTT* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam00535 | Glycos_transf_2 | 9.0e-33 | 9 | 167 | 160 | + Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids. | ||
cd04188 | DPG_synthase | 2.0e-36 | 10 | 203 | 215 | + DPG_synthase is involved in protein N-linked glycosylation. UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. | ||
cd04179 | DPM_DPG-synthase_like | 1.0e-60 | 10 | 180 | 188 | + DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily. DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. The UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. This protein family belongs to Glycosyltransferase 2 superfamily. | ||
cd06442 | DPM1_like | 1.0e-121 | 10 | 219 | 226 | + DPM1_like represents putative enzymes similar to eukaryotic DPM1. Proteins similar to eukaryotic DPM1, including enzymes from bacteria and archaea; DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. This protein family belongs to Glycosyltransferase 2 superfamily. | ||
PLN02726 | PLN02726 | 5.0e-161 | 5 | 223 | 236 | + dolichyl-phosphate beta-D-mannosyltransferase |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
RefSeq | NP_564118.1 | 0 | 5 | 223 | 12 | 246 | dolichyl-phosphate beta-D-mannosyltransferase, putative / dolichol-phosphate mannosyltransferase, putative / mannose-P-dolichol synthase, putative [Arabidopsis thaliana] |
RefSeq | XP_002285933.1 | 0 | 6 | 223 | 10 | 243 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002300644.1 | 0 | 5 | 223 | 6 | 240 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002307788.1 | 0 | 6 | 223 | 5 | 238 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002510671.1 | 0 | 5 | 223 | 4 | 238 | dolichol-phosphate mannosyltransferase, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2z86_D | 0.0000000007 | 9 | 112 | 96 | 197 | A Chain A, Crystal Structure Of Chondroitin Polymerase From Escherichia Coli Strain K4 (K4cp) Complexed With Udp-Glcua And Udp |
PDB | 2z86_C | 0.0000000007 | 9 | 112 | 96 | 197 | A Chain A, Crystal Structure Of Chondroitin Polymerase From Escherichia Coli Strain K4 (K4cp) Complexed With Udp-Glcua And Udp |
PDB | 2z86_B | 0.0000000007 | 9 | 112 | 96 | 197 | A Chain A, Crystal Structure Of Chondroitin Polymerase From Escherichia Coli Strain K4 (K4cp) Complexed With Udp-Glcua And Udp |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
EE260562 | 236 | 5 | 224 | 0 |
DV455514 | 233 | 5 | 221 | 0 |
FC919240 | 233 | 8 | 224 | 0 |
GR054293 | 239 | 2 | 224 | 0 |
DW499473 | 232 | 8 | 223 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|