CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.005G113800.3
FamilyGH13
Protein PropertiesLength: 850 Molecular Weight: 96562.6 Isoelectric Point: 4.8754
ChromosomeChromosome/Scaffold: 05 Start: 21739736 End: 21746069
Descriptionstarch branching enzyme 2.2
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH132876124.5e-29
  LPRIQANNYNTVQLMAVMEHSYYASFGYHVTNFFSVSSRSGTPEDLKYLIDKAHSLGLRVLMDVVHSHASNNVTDGLNGFDVGQSSQESYFHTGERGYHK
  LWDSRLFNYGNWEVLRFLLSNLRWWLEEFKFDGFRFDGVTSMLYHHHGINMPFTGDYNEYFSEATDVDAVVYLMLANSLINNILPDATVIAEDVSGMPGL
  GRPVSEGGIGFDYRLAMAIPDKWIDYLKNKNDEEWSMMDLSCSLTNRRYTEKCISYAESHDQSIVGDKTIAFFLMDKEMYSGMSCLTDASPTIDRGIALH
  KMIHFITMALGGEGYLNFMGNEFGHP
Full Sequence
Protein Sequence     Length: 850     Download
MLGSLSLLVA TPFAFRSFSP SSNNNRSLSS GTNHQIAKQL ATESGRGSQK LLRRHVFPVY    60
RRVSYGSPIS AVMIDDSSTI TTSEENTQNI GILDIDSALR PFKDHFQYRI KKFVDQKNLF    120
ENYEGGLEEF AKGYLRFGFN REEDGIVYRE WAPAAQEAQV VGDFNGWDGS NHKMEKNEFG    180
VWSIKIPDSE GNPAIPHNSR VKFRFKHGDG VWVDRIPAWI KYAIVDPTRF GAPYDGVHWD    240
PPPSERYEFK YPRPPKPKAP RIYEAHVGMS SSEPRINSYR EFADDVLPRI QANNYNTVQL    300
MAVMEHSYYA SFGYHVTNFF SVSSRSGTPE DLKYLIDKAH SLGLRVLMDV VHSHASNNVT    360
DGLNGFDVGQ SSQESYFHTG ERGYHKLWDS RLFNYGNWEV LRFLLSNLRW WLEEFKFDGF    420
RFDGVTSMLY HHHGINMPFT GDYNEYFSEA TDVDAVVYLM LANSLINNIL PDATVIAEDV    480
SGMPGLGRPV SEGGIGFDYR LAMAIPDKWI DYLKNKNDEE WSMMDLSCSL TNRRYTEKCI    540
SYAESHDQSI VGDKTIAFFL MDKEMYSGMS CLTDASPTID RGIALHKMIH FITMALGGEG    600
YLNFMGNEFG HPEWIDFPRE GNGWSYEKCR RQWTLVDTDH LRYKIVSCTD EENKVIVFER    660
GDLVFVFNFH PENTYDGYKV GCDLPGKYRV ALDSDAWEFG GHGRVGHDVD HFTSPEGIPG    720
VPETNFNNRP NSFKVLSPAR TCVVYYKVDE SVEETNGINV ISVSETLEMD ASKQKNAEES    780
AILVDHGDKE NPQETTDRDT SSFDEELQKD GAKQESIEEP AASVLDKKIV GSKLDEPEVE    840
EMEDRTPDD*                                                           900
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02960PLN029602.0e-710018895+
PLN03244PLN032441.0e-129193695529+
PLN02960PLN029606.0e-178193746578+
PLN02447PLN02447036760753+
cd11321AmyAc_bac_euk_BE0243644402+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
GO:0043169cation binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABN05321.104778144808starch branching enzyme I [Populus trichocarpa]
EMBLCAA54308.10181718281,4-alpha-glucan branching enzyme [Manihot esculenta]
EMBLCBI18866.1017861818unnamed protein product [Vitis vinifera]
RefSeqXP_002284841.10307866795PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002510672.10182449904starch branching enzyme II, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3aml_A0807721721A Chain A, Structure Of The Starch Branching Enzyme I (Bei) From Oryza Sativa L
PDB3amk_A0807541699A Chain A, Structure Of The Starch Branching Enzyme I (Bei) From Oryza Sativa L
PDB3vu2_B0807541699A Chain A, Structure Of The Starch Branching Enzyme I (bei) Complexed With Maltopentaose From Oryza Sativa L
PDB3vu2_A0807541699A Chain A, Structure Of The Starch Branching Enzyme I (bei) Complexed With Maltopentaose From Oryza Sativa L
PDB3k1d_A1.4013e-45145703137686A Chain A, Crystal Structure Of Glycogen Branching Enzyme Synonym: 1,4- Glucan:1,4-Alpha-D-Glucan 6-Glucosyl-Transferase From Mycob Tuberculosis H3
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO6191676401767830
HO794536695927500
HO7776386421457500
ES8488703611054630
EY1981433181945110
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_066_00053.1Aquca_027_00415.5Aquca_027_00415.4Aquca_027_00415.3Aquca_027_00415.2
Aquca_027_00415.1Aquca_015_00400.6Aquca_015_00400.5Aquca_015_00400.2Aquca_015_00400.1
Aquca_015_00400.3Aquca_015_00400.4
Arabidopsis lyrata873536321348908239
Arabidopsis thalianaAT3G20440.3AT3G20440.2AT2G36390.1AT5G03650.1
Brachypodium distachyonBradi1g41970.2Bradi1g41970.1Bradi1g29850.2Bradi1g29850.1Bradi5g09170.2
Bradi5g09170.1Bradi3g44760.1
Brassica rapaBra035782Bra005269Bra017241Bra009521
Carica papayaevm.model.supercontig_5.62
Capsella rubellaCarubv10012936mCarubv10022617mCarubv10000235m
Chlamydomonas reinhardtiiCre06.g270100.t1.3Cre10.g444700.t1.1Cre06.g289850.t1.3Cre08.g373450.t1.1
Citrus clementinaCiclev10007401mCiclev10011063mCiclev10000406mCiclev10000374mCiclev10000272m
Ciclev10000256m
Citrus sinensisorange1.1g035501morange1.1g002609morange1.1g004765morange1.1g004253morange1.1g003474m
orange1.1g003390morange1.1g003230morange1.1g003226m
Cucumis sativusCucsa.378410.2Cucsa.378410.1Cucsa.077550.3Cucsa.077550.1Cucsa.077550.2
Eucalyptus grandisEucgr.F03487.1Eucgr.A01533.1Eucgr.F01770.1
Fragaria vescamrna30233.1-v1.0-hybridmrna08644.1-v1.0-hybridmrna08646.1-v1.0-hybrid
Glycine maxGlyma18g10385.1Glyma03g35020.2Glyma03g35020.1Glyma19g37750.2Glyma19g37750.1
Glyma04g01950.2
Gossypium raimondiiGorai.009G406400.4Gorai.011G196000.5Gorai.011G196000.4Gorai.011G196000.3Gorai.011G196000.2
Gorai.011G196000.12Gorai.011G196000.1Gorai.011G196000.7Gorai.011G196000.6Gorai.011G196000.13
Gorai.002G172100.7Gorai.002G172100.5Gorai.002G172100.3Gorai.002G172100.2Gorai.002G172100.1
Gorai.009G441800.2Gorai.009G441800.1Gorai.009G406400.6Gorai.009G406400.5Gorai.009G406400.3
Gorai.009G406400.2Gorai.009G406400.1Gorai.002G241400.7Gorai.002G241400.6Gorai.002G241400.5
Gorai.002G241400.4Gorai.002G241400.2Gorai.002G241400.1Gorai.005G113800.2Gorai.005G113800.1
Linum usitatissimumLus10000912Lus10023878Lus10014382Lus10016012Lus10012264
Malus domesticaMDP0000218396MDP0000148418MDP0000214735MDP0000177786
Manihot esculentacassava4.1_006199mcassava4.1_004366mcassava4.1_003773mcassava4.1_001701mcassava4.1_001686m
cassava4.1_002337mcassava4.1_002172mcassava4.1_002171mcassava4.1_001826mcassava4.1_001598m
cassava4.1_001595m
Medicago truncatulaMedtr7g104080.1
Mimulus guttatusmgv1a001162mmgv1a001301mmgv1a001932m
Oryza sativaLOC_Os02g32660.2LOC_Os06g26234.3LOC_Os06g26234.2LOC_Os06g26234.1LOC_Os02g32660.1
LOC_Os06g51084.8LOC_Os06g51084.7LOC_Os06g51084.6LOC_Os06g51084.5LOC_Os06g51084.4
LOC_Os06g51084.3LOC_Os06g51084.2LOC_Os06g51084.1
Panicum virgatumPavirv00035568mPavirv00058932mPavirv00002278mPavirv00067040mPavirv00061484m
Pavirv00061483mPavirv00061485m
Physcomitrella patensPp1s200_23V6.1Pp1s15_181V6.2Pp1s15_181V6.1Pp1s54_189V6.2Pp1s54_189V6.1
Pp1s64_78V6.1
Phaseolus vulgarisPhvul.006G047000.1Phvul.001G187600.1Phvul.009G011000.1
Picea abiesMA_10430611g0010
Populus trichocarpaPotri.006G115100.5Potri.001G359200.1Potri.006G115100.6Potri.006G115100.4Potri.006G115100.3
Potri.006G115100.2Potri.006G115100.1Potri.005G251000.5Potri.005G251000.4Potri.005G251000.3
Potri.005G251000.2Potri.005G251000.1Potri.005G251000.6
Prunus persicappa016544mppa001312mppa001929m
Ricinus communis29762.m00048630170.m01435927496.m000095
Setaria italicaSi008087mSi016350mSi009379mSi009312mSi005911m
Si006006mSi006081m
Selaginella moellendorffii165481437348437417
Sorghum bicolorSb03g027310.1Sb04g021540.1Sb06g015360.1Sb10g030776.1
Thellungiella halophilaThhalv10020019mThhalv10016249mThhalv10012785mThhalv10012784mThhalv10012679m
Vitis viniferaGSVIVT01037695001GSVIVT01033801001GSVIVT01008673001
Volvox carteriVocar20012173mVocar20015251mVocar20002436mVocar20007338m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)