CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.005G139200.2
FamilyGH13
Protein PropertiesLength: 643 Molecular Weight: 72435.7 Isoelectric Point: 5.4117
ChromosomeChromosome/Scaffold: 05 Start: 36287705 End: 36293693
Descriptionalpha-amylase-like 3
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH132715619.90001e-40
  KEKASEISSLGFTVIWLPPPTESVSPEGYLPKDLYNLNSRYGTIDELKDLVKSLHGVGLKVLGDVVLNHRCAHYQNQNGVWNIFGGRLNWDDRAVVGDDP
  HFQGRGNKSSGDNFHAAPNIDHSQDFVRKDLIEWLCWLREEIGYDGWRLDFVRGFWGGYVKDYLDASEPYFAVGEYWDSLSYTYGEMDHNQDAHRQRIVD
  WINATNGTAGAFDVTTKGILHSALERREYWRLSDQKGKPPGVVGWWPSRAVTFIENHDTGSTQGHWRFPGGKEMQGYAYILTHPGTPAVFY
Full Sequence
Protein Sequence     Length: 643     Download
MIHTKRSFGK WPEASCDSKN ENRRLEGFYE EQPIVKEVSV GNMVNVAIRK FPDAANIVLH    60
LETDIPGDVV VHWGVCRDDA KTWEISAVPY PPETTVFRNK ALRTLLQPTG NGSRALFTLD    120
EKLDGFLFVL KLDANSWVNF QGNDFYIPLS SARSVKGQSD SESEETSGKA HTDGIINEIR    180
NLVSGLNSEK SLQTKVKEAK ESILNEIEKL AAEAYSIFRS STPSYPEEDS DADDAEPTIN    240
ISSGTGSGFE ILCQGFNWES NKSGRWYMEL KEKASEISSL GFTVIWLPPP TESVSPEGYL    300
PKDLYNLNSR YGTIDELKDL VKSLHGVGLK VLGDVVLNHR CAHYQNQNGV WNIFGGRLNW    360
DDRAVVGDDP HFQGRGNKSS GDNFHAAPNI DHSQDFVRKD LIEWLCWLRE EIGYDGWRLD    420
FVRGFWGGYV KDYLDASEPY FAVGEYWDSL SYTYGEMDHN QDAHRQRIVD WINATNGTAG    480
AFDVTTKGIL HSALERREYW RLSDQKGKPP GVVGWWPSRA VTFIENHDTG STQGHWRFPG    540
GKEMQGYAYI LTHPGTPAVF YDHIVSHHRS EIGALISLRN RNKIHCRSIV EIVKAERDVY    600
AATIDDRVAM KIGPGYYEPP SGPQRWSLAL EGYDYKVWEA SS* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02784PLN027840.00353149106+
PLN00196PLN001961.0e-131239639414+
cd11314AmyAc_arch_bac_plant_AmyA6.0e-154251590343+
PLN02361PLN023615.0e-163247639400+
PLN02784PLN02784012641643+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:0004556alpha-amylase activity
GO:0005509calcium ion binding
GO:0005975carbohydrate metabolic process
GO:0043169cation binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI32016.106641240885unnamed protein product [Vitis vinifera]
RefSeqXP_002270049.106641240901PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002520134.1017641259900alpha-amylase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2qpu_C02506392403A Chain A, Sugar Tongs Mutant S378p In Complex With Acarbose
PDB2qpu_B02506392403A Chain A, Sugar Tongs Mutant S378p In Complex With Acarbose
PDB2qpu_A02506392403A Chain A, Sugar Tongs Mutant S378p In Complex With Acarbose
PDB3bsg_A02506392403A Chain A, Barley Alpha-Amylase Isozyme 1 (Amy1) H395a Mutant
PDB1rpk_A02506392403A Chain A, Barley Alpha-Amylase Isozyme 1 (Amy1) H395a Mutant
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EG631183641156410
HO8269814012416410
HO8119912983446410
ES8054483282085340
EG631183138261490.41
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_00499.1.534.822Aquca_002_00499.2.534.792Aquca_043_00069.1Aquca_015_00065.1Aquca_015_00064.1
Aquca_015_00064.2
Arabidopsis lyrata339218.513.801316534492338
Arabidopsis thalianaAT1G69830.1.517.806AT1G76130.1AT4G25000.1
Brachypodium distachyonBradi2g48150.1.502.788Bradi5g08800.3Bradi5g08800.1Bradi1g35050.1Bradi5g08800.2
Bradi4g32140.1Bradi3g58010.1
Brassica rapaBra016262.525.815Bra015784Bra036881
Carica papayaevm.model.supercontig_5.271.357.671evm.model.supercontig_26.242evm.model.supercontig_14.168evm.model.supercontig_49.22evm.model.supercontig_49.17
Capsella rubellaCarubv10019759m.532.819Carubv10020375mCarubv10004897m
Chlamydomonas reinhardtiiCre08.g362450.t1.2Cre08.g385500.t2.1Cre08.g385500.t1.2Cre08.g384750.t1.1
Citrus clementinaCiclev10018086mCiclev10030780m.385.674Ciclev10030661m.533.822Ciclev10001348mCiclev10001266m
Citrus sinensisorange1.1g045962morange1.1g006158m.291.578orange1.1g003698m.435.722orange1.1g003004m.533.820orange1.1g002611m.533.820
orange1.1g002585m.533.820orange1.1g003613m.533.791orange1.1g015125morange1.1g014892morange1.1g004353m.533.733
orange1.1g014447morange1.1g018278morange1.1g021281morange1.1g018833m
Cucumis sativusCucsa.285330.2.390.679Cucsa.285330.1.530.819Cucsa.271900.2Cucsa.271900.1
Eucalyptus grandisEucgr.G02543.2.545.839Eucgr.G02543.1.545.840Eucgr.F03529.1Eucgr.F02347.2Eucgr.F02347.1
Eucgr.F02347.4Eucgr.F02347.3Eucgr.F02349.1
Fragaria vescamrna04286.1-v1.0-hybridmrna08602.1-v1.0-hybridmrna28570.1-v1.0-hybridmrna28571.1-v1.0-hybrid
Glycine maxGlyma08g26861.3Glyma08g26861.2Glyma08g26861.1Glyma08g26861.4Glyma02g02450.1.530.816
Glyma08g40810.1.553.842Glyma14g39930.1Glyma17g36090.1
Gossypium raimondiiGorai.007G082900.3Gorai.007G082900.2Gorai.007G082900.1Gorai.007G082900.4Gorai.008G182600.3.522.810
Gorai.008G182600.1.524.812Gorai.005G139200.3Gorai.005G139200.1Gorai.008G182600.6.524.783Gorai.007G082900.5
Gorai.010G001000.2Gorai.010G001000.1Gorai.009G268400.1Gorai.008G182600.4.524.727Gorai.008G182600.5.524.726
Gorai.008G182600.2.524.726Gorai.009G211600.1Gorai.009G211600.2Gorai.002G132300.1Gorai.009G268400.2
Linum usitatissimumLus10036717.524.811Lus10013270.535.823Lus10030793.532.820Lus10037211.523.823Lus10021836
Lus10042655Lus10021728
Malus domesticaMDP0000210170MDP0000261503MDP0000162817.633.919MDP0000167257MDP0000298815.275.582
MDP0000298815.275.582MDP0000298815.637.941MDP0000298815.637.941MDP0000417791MDP0000135529
Manihot esculentacassava4.1_028069mcassava4.1_001555m.526.816cassava4.1_001362m.526.816cassava4.1_025145mcassava4.1_008802m
cassava4.1_008754mcassava4.1_008351mcassava4.1_008126mcassava4.1_023754m
Medicago truncatulaMedtr1g019440.1Medtr7g013300.1Medtr1g026170.1Medtr1g019480.1
Mimulus guttatusmgv1a001047mmgv1a001104m.518.806mgv1a001785mmgv1a007250mmgv1a006910m
Oryza sativaLOC_Os01g51754.2LOC_Os01g51754.1LOC_Os04g33040.1LOC_Os06g49970.2LOC_Os08g36900.1
LOC_Os08g36910.2LOC_Os08g36910.1LOC_Os09g28420.1LOC_Os08g36900.2LOC_Os09g28400.1
LOC_Os02g52700.1LOC_Os08g36910.3LOC_Os02g52710.1
Panicum virgatumPavirv00030888m.502.788Pavirv00061832m.515.801Pavirv00065049mPavirv00023068mPavirv00055456m
Pavirv00012930mPavirv00053436mPavirv00035106mPavirv00011095mPavirv00029041m
Pavirv00048051mPavirv00009684mPavirv00049157mPavirv00043521mPavirv00039683m
Pavirv00050888mPavirv00007311mPavirv00048050mPavirv00022620mPavirv00060260m
Pavirv00027292m
Physcomitrella patensPp1s342_20V6.1Pp1s100_191V6.1Pp1s223_59V6.2Pp1s223_59V6.1Pp1s13_335V6.1
Pp1s526_11V6.2Pp1s526_11V6.1Pp1s7_147V6.3Pp1s7_147V6.2Pp1s7_147V6.1
Pp1s148_45V6.1
Phaseolus vulgarisPhvul.008G033800.1Phvul.002G065700.1.549.837Phvul.003G069200.1.555.843Phvul.001G001900.1Phvul.010G017600.1
Picea abiesMA_30833g0020MA_17799g0010MA_400732g0010MA_336273g0010
Populus trichocarpaPotri.002G126300.1Potri.017G093200.1Potri.010G092900.7Potri.010G092900.5.536.826Potri.010G092900.4.532.822
Potri.010G092900.3.547.837Potri.010G092900.2.543.833Potri.010G092900.1.547.837Potri.010G092900.6.547.806Potri.002G014300.6
Potri.002G014300.5Potri.002G014300.4Potri.002G014300.3Potri.002G014300.2Potri.002G014300.1
Potri.014G029400.1Potri.002G126300.2
Prunus persicappa000951mppa001575m.432.720ppa006402mppa006152mppa006160m
Ricinus communis29630.m00083329736.m002033.533.82130170.m01430930170.m01387730170.m013878
32625.m000028
Setaria italicaSi000308m.516.802Si000258m.516.802Si010227mSi010224mSi006474m
Si013788mSi013755mSi022119mSi013704mSi029876m
Si029874mSi029873mSi013789mSi022334mSi008671m
Si006461mSi017283mSi032583mSi027629m
Selaginella moellendorffii127605976253394079072404058
Sorghum bicolorSb04g034150.1Sb03g032830.1.455.740Sb06g015110.1Sb02g026620.1Sb02g026610.1
Sb07g023020.2Sb07g023020.1Sb07g023010.1Sb02g023790.1Sb04g034140.1
Sb02g023250.1
Thellungiella halophilaThhalv10018099m.531.819Thhalv10018632mThhalv10018631mThhalv10025232m
Vitis viniferaGSVIVT01031746001GSVIVT01032922001GSVIVT01020069001.513.804GSVIVT01008714001GSVIVT01031740001
Volvox carteriVocar20003157mVocar20004587m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)