Basic Information | |
---|---|
Species | Gossypium raimondii |
Cazyme ID | Gorai.007G068800.6 |
Family | GH16 |
Protein Properties | Length: 216 Molecular Weight: 25441.7 Isoelectric Point: 8.1778 |
Chromosome | Chromosome/Scaffold: 07 Start: 4863999 End: 4865550 |
Description | xyloglucan endotransglucosylase/hydrolase 5 |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH16 | 2 | 132 | 1.3e-21 |
QIKLVPGDSAGTVTAFYLSSQNSEHDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIYLWFDPTKEYHSYSVLWNMYQIVFFVDDIPIRVFKNCKDLG VRFPFNQPMKIYSSLWNADDWATRGGLEKTD |
Full Sequence |
---|
Protein Sequence Length: 216 Download |
MQIKLVPGDS AGTVTAFYLS SQNSEHDEID FEFLGNRTGQ PYILQTNVFT GGKGDREQRI 60 YLWFDPTKEY HSYSVLWNMY QIVFFVDDIP IRVFKNCKDL GVRFPFNQPM KIYSSLWNAD 120 DWATRGGLEK TDWSKAPFIA AYKSFHIDGC ESSVEAKFCA TQGKRWWDQK AFQDLDAYQW 180 RRLRWVRNKF TIYNYCSDRV RYPTMSPECK RDRDA* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam06955 | XET_C | 2.0e-19 | 159 | 209 | 52 | + Xyloglucan endo-transglycosylase (XET) C-terminus. This family represents the C-terminus (approximately 60 residues) of plant xyloglucan endo-transglycosylase (XET). Xyloglucan is the predominant hemicellulose in the cell walls of most dicotyledons. With cellulose, it forms a network that strengthens the cell wall. XET catalyzes the splitting of xyloglucan chains and the linking of the newly generated reducing end to the non-reducing end of another xyloglucan chain, thereby loosening the cell wall. Note that all family members contain the pfam00722 domain. | ||
cd02183 | GH16_fungal_CRH1_transglycosylase | 3.0e-24 | 2 | 147 | 161 | + glycosylphosphatidylinositol-glucanosyltransferase. Group of fungal GH16 members related to Saccharomyces cerevisiae Crh1p. Chr1p and Crh2p are transglycosylases that are required for the linkage of chitin to beta(1-3)glucose branches of beta(1-6)glucan, an important step in the assembly of new cell wall. Both have been shown to be glycosylphosphatidylinositol (GPI)-anchored. A third homologous protein, Crr1p, functions in the formation of the spore wall. They belongs to the family 16 of glycosyl hydrolases that includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues. | ||
pfam00722 | Glyco_hydro_16 | 1.0e-59 | 1 | 135 | 137 | + Glycosyl hydrolases family 16. | ||
PLN03161 | PLN03161 | 1.0e-86 | 1 | 209 | 213 | + Probable xyloglucan endotransglucosylase/hydrolase protein; Provisional | ||
cd02176 | GH16_XET | 2.0e-138 | 1 | 209 | 211 | + Xyloglucan endotransglycosylase, member of glycosyl hydrolase family 16. Xyloglucan endotransglycosylases (XETs) cleave and religate xyloglucan polymers in plant cell walls via a transglycosylation mechanism. Xyloglucan is a soluble hemicellulose with a backbone of beta-1,4-linked glucose units, partially substituted with alpha-1,6-linked xylopyranose branches. It binds noncovalently to cellulose, cross-linking the adjacent cellulose microfibrils, giving it a key structural role as a matrix polymer. Therefore, XET plays an important role in all plant processes that require cell wall remodeling. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
GO:0005618 | cell wall |
GO:0005975 | carbohydrate metabolic process |
GO:0006073 | cellular glucan metabolic process |
GO:0016762 | xyloglucan:xyloglucosyl transferase activity |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | AAB39950.1 | 0 | 1 | 214 | 79 | 292 | xyloglucan endotransglycosylase [Tropaeolum majus] |
GenBank | ABB72441.1 | 0 | 1 | 214 | 80 | 293 | xyloglucan endotransglucosylase [Betula pendula] |
GenBank | ACD03215.1 | 0 | 1 | 215 | 79 | 293 | xyloglucan endotransglucosylase/hydrolase 5 [Actinidia deliciosa] |
GenBank | ACT67416.1 | 0 | 1 | 214 | 79 | 292 | xyloglucan endotransglycosylase [Shorea parvifolia subsp. parvifolia] |
RefSeq | XP_002512703.1 | 0 | 1 | 215 | 104 | 318 | Xyloglucan endotransglucosylase/hydrolase protein A precursor, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 1un1_B | 0 | 1 | 214 | 64 | 277 | A Chain A, Crystal Structure Of Nxg1-Deltayniig In Complex With Xllg, A Xyloglucan Derived Oligosaccharide |
PDB | 1un1_A | 0 | 1 | 214 | 64 | 277 | A Chain A, Crystal Structure Of Nxg1-Deltayniig In Complex With Xllg, A Xyloglucan Derived Oligosaccharide |
PDB | 1umz_B | 0 | 1 | 214 | 64 | 277 | A Chain A, Xyloglucan Endotransglycosylase In Complex With The Xyloglucan Nonasaccharide Xllg. |
PDB | 1umz_A | 0 | 1 | 214 | 64 | 277 | A Chain A, Xyloglucan Endotransglycosylase In Complex With The Xyloglucan Nonasaccharide Xllg. |
PDB | 2uwb_B | 0 | 3 | 209 | 67 | 267 | A Chain A, Crystal Structure Of The Nasturtium Seedling Mutant Xyloglucanase Isoform Nxg1-Delta-Yniig |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
DT554837 | 216 | 1 | 216 | 0 |
CO115518 | 216 | 1 | 216 | 0 |
DT559563 | 216 | 1 | 216 | 0 |
DT571943 | 216 | 1 | 216 | 0 |
DT573127 | 216 | 1 | 216 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|