Basic Information | |
---|---|
Species | Gossypium raimondii |
Cazyme ID | Gorai.007G238800.4 |
Family | AA2 |
Protein Properties | Length: 200 Molecular Weight: 21787.7 Isoelectric Point: 9.8656 |
Chromosome | Chromosome/Scaffold: 07 Start: 32592919 End: 32594205 |
Description | peroxidase 2 |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
AA2 | 9 | 181 | 2.7e-29 |
GGPTWKVPLGRRDSRTAHREGTGTIPTGHESLANIATLFKSMGLDSTDLVALSGVHTFGRARCAAFMDRLYNFNNVSGKIDPILNGTYAKTLRQLCPKGG DVTSLIDLDEQTSLTFDNKYFLNLQNRRGLLQTDQELFSTKGAETVAIVNRFASSQSQFFNSFAKAMIKMGNI |
Full Sequence |
---|
Protein Sequence Length: 200 Download |
MSVFGLQGGG PTWKVPLGRR DSRTAHREGT GTIPTGHESL ANIATLFKSM GLDSTDLVAL 60 SGVHTFGRAR CAAFMDRLYN FNNVSGKIDP ILNGTYAKTL RQLCPKGGDV TSLIDLDEQT 120 SLTFDNKYFL NLQNRRGLLQ TDQELFSTKG AETVAIVNRF ASSQSQFFNS FAKAMIKMGN 180 INPLTGTNGE IRLDCRKTN* |
Functional Domains Download unfiltered results here | ||||||
---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description |
cd00314 | plant_peroxidase_like | 9.0e-12 | 1 | 180 | 201 | + Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase. |
pfam00141 | peroxidase | 1.0e-18 | 9 | 65 | 57 | + Peroxidase. |
PLN03030 | PLN03030 | 1.0e-38 | 10 | 199 | 194 | + cationic peroxidase; Provisional |
cd00693 | secretory_peroxidase | 2.0e-84 | 9 | 198 | 190 | + Horseradish peroxidase and related secretory plant peroxidases. Secretory peroxidases belong to class III of the plant heme-dependent peroxidase superfamily. All members of the superfamily share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Class III peroxidases are found in the extracellular space or in the vacuole in plants where they have been implicated in hydrogen peroxide detoxification, auxin catabolism and lignin biosynthesis, and stress response. Class III peroxidases contain four conserved disulphide bridges and two conserved calcium binding sites. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004601 | peroxidase activity |
GO:0006979 | response to oxidative stress |
GO:0020037 | heme binding |
GO:0055114 | oxidation-reduction process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PIR | 0 | 8 | 199 | 132 | 318 | UP10_LACSN Unknown protein 10 from 2D-PAGE | |
GenBank | AAQ67366.1 | 0 | 8 | 199 | 131 | 322 | POD9 precursor [Gossypium hirsutum] |
RefSeq | XP_002285649.1 | 0 | 8 | 199 | 134 | 325 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002299145.1 | 0 | 8 | 199 | 132 | 318 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002530724.1 | 0 | 9 | 199 | 143 | 333 | Peroxidase 53 precursor, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 1qo4_A | 0 | 8 | 199 | 113 | 304 | A Chain A, Recombinant Horseradish Peroxidase Phe209ser Complex With Benzhydroxamic Acid |
PDB | 1pa2_A | 0 | 8 | 199 | 113 | 304 | A Chain A, Arabidopsis Thaliana Peroxidase A2 |
PDB | 4a5g_B | 0 | 9 | 199 | 115 | 305 | A Chain A, Raphanus Sativus Anionic Peroxidase. |
PDB | 4a5g_A | 0 | 9 | 199 | 115 | 305 | A Chain A, Raphanus Sativus Anionic Peroxidase. |
PDB | 1gx2_B | 0 | 8 | 199 | 113 | 306 | A Chain A, Recombinant Horseradish Peroxidase Phe209ser Complex With Benzhydroxamic Acid |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
DT467403 | 188 | 13 | 200 | 0 |
DT465844 | 183 | 18 | 200 | 0 |
FF403651 | 179 | 8 | 186 | 0 |
JG855468 | 173 | 8 | 180 | 0 |
DT462651 | 173 | 28 | 200 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|
![]() |