Basic Information | |
---|---|
Species | Gossypium raimondii |
Cazyme ID | Gorai.008G135800.2 |
Family | CBM43 |
Protein Properties | Length: 118 Molecular Weight: 12636.2 Isoelectric Point: 9.0695 |
Chromosome | Chromosome/Scaffold: 08 Start: 38409251 End: 38411113 |
Description | Carbohydrate-binding X8 domain superfamily protein |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 31 | 114 | 2.5e-32 |
WCIAKPSTENLRLNGNINYSCSQKGVDCKPIQPGGTCYRPNTIVSHASYAMNLFYKAAGKNSWNCHFNGTGIIISENPSIGSCN |
Full Sequence |
---|
Protein Sequence Length: 118 Download |
MGVVLLHADA RRHGNGRNSN QKASSGGENT WCIAKPSTEN LRLNGNINYS CSQKGVDCKP 60 IQPGGTCYRP NTIVSHASYA MNLFYKAAGK NSWNCHFNGT GIIISENPSI GSCNYPM* 120 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 6.0e-18 | 30 | 102 | 78 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 3.0e-34 | 30 | 115 | 86 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2JON | 4e-32 | 30 | 116 | 12 | 97 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
GenBank | AAK58515.1 | 1e-30 | 30 | 116 | 371 | 456 | AF249675_1 beta-1,3-glucanase-like protein [Olea europaea] |
RefSeq | XP_002273170.1 | 1e-37 | 26 | 115 | 41 | 130 | PREDICTED: similar to At2g43670 [Vitis vinifera] |
RefSeq | XP_002320265.1 | 3.00018e-42 | 6 | 117 | 23 | 134 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002515203.1 | 1e-39 | 8 | 108 | 25 | 129 | hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 6e-34 | 30 | 116 | 12 | 97 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
ES800471 | 110 | 9 | 118 | 0 |
CU600726 | 109 | 10 | 118 | 0 |
CU472860 | 109 | 10 | 118 | 0 |
CU586228 | 109 | 10 | 118 | 0 |
DC887887 | 113 | 7 | 118 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|