y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.008G209800.2
FamilyGT29
Protein PropertiesLength: 422 Molecular Weight: 47155.1 Isoelectric Point: 8.5187
ChromosomeChromosome/Scaffold: 08 Start: 49512734 End: 49516992
DescriptionGlycosyltransferase family 29 (sialyltransferase) family protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT291273250
  NCKNRTLCMEKLSLVLPETPPYVPRQFGRCAVIGNSGDLLKTRFGKEIDSYDVVIRENGAPIENYTEYVGKKSSFRLLNRGSAKALDKVVELDETRQEVL
  IVKTTIHDIMNQMILDIPIRNPVYLMLGASFGSAAKGTGLKALEFALSICDSVDMYGFTVDPGYKEWTRYFSESRKGHTPLHGRAYYQMMECLGLIKIH
Full Sequence
Protein Sequence     Length: 422     Download
MNIPLSSTSL DSPLILTDED WQALQSLQSG FKKCVTENGL GLQAISGKDY CQVTLTYPSD    60
TDSKWKDPKT GEVEGLSFEF NLCEAVATWE QVRNSTTILT REFIDALPNG WEEYAWRRIN    120
KGVLLNNCKN RTLCMEKLSL VLPETPPYVP RQFGRCAVIG NSGDLLKTRF GKEIDSYDVV    180
IRENGAPIEN YTEYVGKKSS FRLLNRGSAK ALDKVVELDE TRQEVLIVKT TIHDIMNQMI    240
LDIPIRNPVY LMLGASFGSA AKGTGLKALE FALSICDSVD MYGFTVDPGY KEWTRYFSES    300
RKGHTPLHGR AYYQMMECLG LIKIHSPMRS DPNRAVKWVP SQSAIRAARI ASEKLLRRVG    360
AGSEDLLSSC SILKKQVKRK HMSISSLRKA AVDHQKFVKG TTMYPLEHNP GHGQLCTVPA    420
D*                                                                   480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00777Glyco_transf_295.0e-53132328246+
Gene Ontology
GO TermDescription
GO:0006486protein glycosylation
GO:0008373sialyltransferase activity
GO:0030173integral to Golgi membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAJ15144.101642137442sialyltransferase-like [Glycine max]
RefSeqXP_002284431.101541934438PREDICTED: hypothetical protein isoform 1 [Vitis vinifera]
RefSeqXP_002284437.102341933429PREDICTED: hypothetical protein isoform 2 [Vitis vinifera]
RefSeqXP_002322294.101642135441predicted protein [Populus trichocarpa]
RefSeqXP_002511111.10942128437alpha-2,8-sialyltransferase 8b, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2wnf_A0.0000000000000515530099262A Chain A, D34 Region Of Human Ankyrin-R And Linker
PDB2wnb_A0.0000000000000515530099262A Chain A, Crystal Structure Of A Mammalian Sialyltransferase In Complex With Disaccharide And Cmp
PDB2wml_A0.0000000000000515530099262A Chain A, Crystal Structure Of A Mammalian Sialyltransferase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO872329352483990
CO131152267162820
GO846621310283340
GO793432285963800
GO8851623001124110
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_004_00108.5Aquca_019_00142.1Aquca_004_00108.4Aquca_004_00108.3Aquca_004_00108.2
Aquca_004_00108.1
Arabidopsis lyrata906136470934
Arabidopsis thalianaAT3G48820.2AT3G48820.1AT1G08660.1AT1G08660.2
Brachypodium distachyonBradi3g01700.2Bradi3g01700.3Bradi3g01700.1Bradi1g67467.1
Brassica rapaBra019569Bra031637
Carica papayaevm.model.supercontig_4.113evm.model.supercontig_70.73
Capsella rubellaCarubv10017505mCarubv10017208mCarubv10009607mCarubv10009038m
Citrus clementinaCiclev10031577mCiclev10031575mCiclev10031902m
Citrus sinensisorange1.1g013814morange1.1g013792morange1.1g017903morange1.1g017882morange1.1g022244m
orange1.1g019465morange1.1g011883m
Cucumis sativusCucsa.014710.2Cucsa.014710.1Cucsa.156010.2Cucsa.156010.1
Eucalyptus grandisEucgr.F04117.1Eucgr.I01604.1Eucgr.G01933.1
Fragaria vescamrna06450.1-v1.0-hybridmrna01393.1-v1.0-hybrid
Glycine maxGlyma05g34110.1Glyma08g05580.4Glyma08g05580.3Glyma08g05580.1Glyma08g05580.2
Glyma19g27546.1Glyma16g05340.1
Gossypium raimondiiGorai.008G209800.1Gorai.005G137400.2Gorai.005G137400.1Gorai.005G137400.3
Linum usitatissimumLus10032547Lus10043193Lus10035162Lus10031992
Malus domesticaMDP0000239581MDP0000149927MDP0000165459MDP0000211019MDP0000304668
MDP0000244138
Manihot esculentacassava4.1_007830mcassava4.1_008832m
Medicago truncatulaMedtr7g084010.1Medtr8g099840.2Medtr8g099840.1
Mimulus guttatusmgv1a023151mmgv1a005647m
Oryza sativaLOC_Os02g02620.1LOC_Os11g36420.1
Panicum virgatumPavirv00016935mPavirv00068699mPavirv00023972mPavirv00062875mPavirv00062874m
Physcomitrella patensPp1s457_24V6.1Pp1s209_60V6.1
Phaseolus vulgarisPhvul.002G327200.1Phvul.001G084900.1
Picea abiesMA_30391g0010MA_932319g0010
Populus trichocarpaPotri.015G104100.1Potri.014G145400.2Potri.014G145400.1
Prunus persicappa005917mppa005273m
Ricinus communis30147.m01442930131.m006986
Setaria italicaSi017190mSi026296m
Selaginella moellendorffii406168831178267676584403717
760757656779823
Sorghum bicolorSb04g001370.1Sb05g022210.1
Thellungiella halophilaThhalv10010382mThhalv10007525m
Vitis viniferaGSVIVT01008625001GSVIVT01032992001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)