y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.008G219000.2
FamilyGT77
Protein PropertiesLength: 392 Molecular Weight: 44143.9 Isoelectric Point: 9.1025
ChromosomeChromosome/Scaffold: 08 Start: 50544837 End: 50553273
Descriptionxyloglucanase 113
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT771433670
  VSNLLVGAMDTKLLKALYWKGIPVFDMGSHISTDDVGWGSPIFHKMGRQKVLLINAILPFGFELLMCDTDMVWLKNPLPYLARYPDADILTSSDQVVPTV
  VDDRLADWKQVGAAYNIGIFHWRPTPPAKKLAKEWIDMLLADDRIWDQNGFNELVRRQTGPAFDDESGIFYSYDGNLKLGILPESLFCSGHTYFVQALHQ
  QFRLQPYALHTTFQYAGTEGKRHRL
Full Sequence
Protein Sequence     Length: 392     Download
MRGWRNAVQE TAASKPLFLT IYATVILGTV VSSFYVFSAI YSPTASPTRS ISSSWLLAPP    60
LSQNGVSLSS NISQPSQHRS NKLRPIWEAP SRTSKMPRLK SFRLTKELVA QRAKDNVIIV    120
TFGNFAFMDF ILTWVKHLTD LGVSNLLVGA MDTKLLKALY WKGIPVFDMG SHISTDDVGW    180
GSPIFHKMGR QKVLLINAIL PFGFELLMCD TDMVWLKNPL PYLARYPDAD ILTSSDQVVP    240
TVVDDRLADW KQVGAAYNIG IFHWRPTPPA KKLAKEWIDM LLADDRIWDQ NGFNELVRRQ    300
TGPAFDDESG IFYSYDGNLK LGILPESLFC SGHTYFVQAL HQQFRLQPYA LHTTFQYAGT    360
EGKRHRLREA MVFFDPPEYY DAPGISVPAI L*                                  420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03407Nucleotid_trans8.0e-49143367231+
Gene Ontology
GO TermDescription
GO:0005783endoplasmic reticulum
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAH19600.1013842400AT2G35610 [Arabidopsis thaliana]
EMBLCAN79199.1084385127428hypothetical protein [Vitis vinifera]
RefSeqNP_850250.1013842400unknown protein [Arabidopsis thaliana]
RefSeqXP_002328759.10438415394predicted protein [Populus trichocarpa]
RefSeqXP_002519934.1013841396reticulon3-A3, putative [Ricinus communis]
Transmembrane Domains
StartEnd
1739
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DT5119932681173840
GR7084012561293840
GR7084052561293840
DT5670462461393840
EE6374522541303830
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_011_00317.5Aquca_011_00317.4Aquca_011_00317.3Aquca_011_00317.2Aquca_011_00317.1
Arabidopsis lyrata902666
Arabidopsis thalianaAT2G35610.1
Brachypodium distachyonBradi1g15410.1Bradi3g45950.1
Brassica rapaBra017310Bra005325
Carica papayaevm.model.supercontig_90.39
Capsella rubellaCarubv10022808m
Chlamydomonas reinhardtiig13982.t1g15149.t1Cre02.g082950.t1.3Cre01.g000400.t1.2Cre01.g000450.t1.2
g4580.t1Cre07.g340950.t1.3Cre04.g224350.t1.3Cre01.g000500.t1.3Cre09.g416650.t1.2
Cre13.g574100.t1.2Cre13.g574041.t1.1Cre13.g574050.t1.2Cre07.g332500.t1.2
Citrus clementinaCiclev10011269m
Citrus sinensisorange1.1g036925m
Cucumis sativusCucsa.018320.1Cucsa.018320.10Cucsa.018320.3
Eucalyptus grandisEucgr.E01147.2Eucgr.E01147.1
Fragaria vescamrna10921.1-v1.0-hybrid
Glycine maxGlyma11g09650.2Glyma01g35690.1Glyma16g08350.1Glyma16g20730.1Glyma16g08350.3
Glyma16g08350.2
Gossypium raimondiiGorai.004G177500.4Gorai.004G177500.5Gorai.004G177500.6Gorai.004G177500.7Gorai.004G177500.9
Gorai.004G177500.2Gorai.004G177500.3Gorai.004G177500.1Gorai.008G219000.1Gorai.004G177500.8
Linum usitatissimumLus10005034Lus10027804
Malus domesticaMDP0000349223
Manihot esculentacassava4.1_003398mcassava4.1_008884m
Medicago truncatulaMedtr8g072310.1Medtr5g025590.1
Mimulus guttatusmgv1a002766m
Oryza sativaLOC_Os03g38930.1
Panicum virgatumPavirv00057126mPavirv00045617mPavirv00069114m
Physcomitrella patensPp1s46_165V6.1
Phaseolus vulgarisPhvul.003G278500.1Phvul.002G122000.1
Picea abiesMA_486176g0010MA_10433213g0010
Populus trichocarpaPotri.004G235800.1Potri.004G235800.2
Prunus persicappa002815m
Ricinus communis29827.m002651
Setaria italicaSi034728m
Selaginella moellendorffii127789
Sorghum bicolorSb01g015590.1
Thellungiella halophilaThhalv10016368m
Vitis viniferaGSVIVT01036881001
Volvox carteriVocar20007251mVocar20009385mVocar20010418mVocar20002020mVocar20004159m
Vocar20001219mVocar20001335mVocar20001723mVocar20006862mVocar20009663m
Vocar20008350mVocar20001348m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)