y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.008G221800.1
FamilyGT1
Protein PropertiesLength: 514 Molecular Weight: 55483.2 Isoelectric Point: 6.2533
ChromosomeChromosome/Scaffold: 08 Start: 50829771 End: 50831857
DescriptionUDP-glucosyl transferase 73C7
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT11674891.3e-39
  LKQGPPPGPPPPQLGGFGFPRGPPGPPPPPAADGFPLGHPPPKMGPPQPGGQPQWMETAKDSVALMLNSCHELEGPFLDYLRLQIGKPVWGVGPLLPQQF
  WKSSDSLLHDREIRANKQSNVTEDQVMGWLDSKPHGSVLYVSFGTEVAPTKQQFQQLADALEASNRPFIWVIQHGSGRPGPPPGPPQFLGNQPGSNDVVF
  EEEGYFPHGLDQKVGKRGLIIHGWAPQLLILSHASTGGFLSHCGWNSTVEAIGRGVPLLAWPIRGDQHSNAKLVVNHLKVGCMISDNLAQQNIKKDDIAE
  GIERLMGNEDIKTQAVMLSTKFQ
Full Sequence
Protein Sequence     Length: 514     Download
MSSESQIWVI PFFGQGHLLP SMELCKHIAS RNFKATLIIS SNLSSSIPSS FHDHPLIQVA    60
QIPSSSPTPP ELSSGPHHHH SDLAQGIASL LENTSQPACA VIDNMMDWTA DIFKKLKIPT    120
IAFFTSGACS AALEFAMWKA RVVDIEPGET ILLPGLPEEM ALTDSDLKQG PPPGPPPPQL    180
GGFGFPRGPP GPPPPPAADG FPLGHPPPKM GPPQPGGQPQ WMETAKDSVA LMLNSCHELE    240
GPFLDYLRLQ IGKPVWGVGP LLPQQFWKSS DSLLHDREIR ANKQSNVTED QVMGWLDSKP    300
HGSVLYVSFG TEVAPTKQQF QQLADALEAS NRPFIWVIQH GSGRPGPPPG PPQFLGNQPG    360
SNDVVFEEEG YFPHGLDQKV GKRGLIIHGW APQLLILSHA STGGFLSHCG WNSTVEAIGR    420
GVPLLAWPIR GDQHSNAKLV VNHLKVGCMI SDNLAQQNIK KDDIAEGIER LMGNEDIKTQ    480
AVMLSTKFQQ GFPASSAVSL DAFKDFIVNL NAH*                                540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02863PLN028632.0e-61157174+
PLN02534PLN025342.0e-43223478272+
PLN03007PLN030072.0e-46223447229+
PLN02863PLN028631.0e-50228511290+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACB56927.10650724540glycosyltransferase UGT95A1 [Hieracium pilosella]
EMBLCAN78332.1065074504hypothetical protein [Vitis vinifera]
RefSeqXP_002303461.1065074532predicted protein [Populus trichocarpa]
RefSeqXP_002512998.1015071461UDP-glucosyltransferase, putative [Ricinus communis]
RefSeqXP_002519853.1065074473UDP-glucosyltransferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vg8_A2e-3524784433A Chain A, Crystal Structure Of The Precursor Of Galactose Oxidase
PDB2vch_A2e-3524784433A Chain A, Crystal Structure Of The Precursor Of Galactose Oxidase
PDB2vce_A2e-3524784433A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB2pq6_A2e-32649110459A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2acv_B2e-2714826433A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
ES8084322742214900
ES792867365514110
DT56456730513050
DT5647572362214560
ES808432344795120.00000002
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_022_00107.1
Citrus clementinaCiclev10003109mCiclev10003233m
Citrus sinensisorange1.1g046077m
Eucalyptus grandisEucgr.E01244.1Eucgr.E01245.1Eucgr.E01246.1Eucgr.D02610.1
Fragaria vescamrna13533.1-v1.0-hybridmrna13530.1-v1.0-hybridmrna13529.1-v1.0-hybridmrna09273.1-v1.0-hybrid
Linum usitatissimumLus10007597Lus10012148
Malus domesticaMDP0000193902MDP0000702557MDP0000209283
Manihot esculentacassava4.1_034227m
Medicago truncatulaMedtr5g027210.1
Mimulus guttatusmgv1a023076mmgv1a004898m
Phaseolus vulgarisPhvul.002G132100.1
Picea abiesMA_10434239g0010MA_4725513g0010
Populus trichocarpaPotri.001G133000.1Potri.001G133000.2Potri.003G100500.1Potri.001G133100.1
Prunus persicappa027159mppa003819m
Ricinus communis30131.m00713329827.m002568
Vitis viniferaGSVIVT01022634001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny