y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.009G027500.2
FamilyGT21
Protein PropertiesLength: 388 Molecular Weight: 43243.6 Isoelectric Point: 6.4523
ChromosomeChromosome/Scaffold: 09 Start: 2087486 End: 2091915
DescriptionNucleotide-diphospho-sugar transferases superfamily protein
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT21842738.4e-34
  PRVSVVMPLKGFGEHNLHNWKSQITSLYGGPIEFLFVVESTEDPAYHAVSQLITEFKGDVDARVIVAGLSTTCSQKIHNQLVGVENMHKDSKYVLFLDDD
  VRFHPGSIGVLTTEMEKNPEIFIQTGYPLDLPSGTLGSYCIYEYHMPCSMGFATGGKTFFLWGGCMMMHADDFRHDNYGVVSGLRDGGYS
Full Sequence
Protein Sequence     Length: 388     Download
MSALHSADSF LLSLSRAFCS PLAVFIQIQG CVICLTLAIG WAFAAYVRKR EINRIEDGIK    60
GGNSFAFLCH DIYELEHSNQ VNLPRVSVVM PLKGFGEHNL HNWKSQITSL YGGPIEFLFV    120
VESTEDPAYH AVSQLITEFK GDVDARVIVA GLSTTCSQKI HNQLVGVENM HKDSKYVLFL    180
DDDVRFHPGS IGVLTTEMEK NPEIFIQTGY PLDLPSGTLG SYCIYEYHMP CSMGFATGGK    240
TFFLWGGCMM MHADDFRHDN YGVVSGLRDG GYSDDMTLAA IAGAHKRLIT SPPVAVFPHP    300
IASDLTFSRY WNYLRKQTFV LESYISTVNW LMNRALFLTH FYLSWGFVAP YFMAMVHVAA    360
ALQIYIKGYS YGETTCTSGG EHTLFPF*                                       420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR03472HpnI0.000284200119+
pfam13641Glyco_tranf_2_37.0e-684257181+
COG1215COG12152.0e-879368307+
cd02520Glucosylceramide_synthase3.0e-984204124+
pfam13506Glyco_transf_214.0e-10143315177+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAK73021.1023803381AF367245_1 ceramide glucosyltransferase [Gossypium arboreum]
GenBankAAL11579.1013801380AF424585_1 At2g19880/F6F22.9 [Arabidopsis thaliana]
GenBankABK95617.1053803378unknown [Populus trichocarpa]
RefSeqXP_002329645.1013801387predicted protein [Populus trichocarpa]
RefSeqXP_002514215.1023805383ceramide glucosyltransferase, putative [Ricinus communis]
Transmembrane Domains
StartEnd
2345
342364
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DV125113265953590
DT7651012761053800
EL441917271483180
GR45952827312730
DT74457327822790
Orthologous Group
SpeciesID
Arabidopsis lyrata319569
Arabidopsis thalianaAT2G19880.1AT2G19880.2
Brachypodium distachyonBradi2g58060.1
Brassica rapaBra036698Bra039028Bra031106
Carica papayaevm.model.supercontig_40.95
Capsella rubellaCarubv10013384m
Citrus clementinaCiclev10008006m
Citrus sinensisorange1.1g010062m
Cucumis sativusCucsa.288830.1
Eucalyptus grandisEucgr.C03729.1
Fragaria vescamrna11297.1-v1.0-hybrid
Glycine maxGlyma08g03760.1Glyma01g01130.1Glyma05g35860.2Glyma16g08510.1
Gossypium raimondiiGorai.010G077100.1Gorai.010G077100.2Gorai.009G027500.1
Linum usitatissimumLus10034973
Malus domesticaMDP0000289917MDP0000035240MDP0000126193
Manihot esculentacassava4.1_005602mcassava4.1_007721m
Medicago truncatulaMedtr8g102490.1Medtr8g102500.1
Mimulus guttatusmgv1a004497mmgv1a004580m
Oryza sativaLOC_Os01g67870.1
Panicum virgatumPavirv00019095mPavirv00063321m
Physcomitrella patensPp1s194_131V6.1
Phaseolus vulgarisPhvul.004G176200.1Phvul.002G308700.1
Populus trichocarpaPotri.018G087700.3Potri.018G087700.2Potri.018G087700.1Potri.006G164800.2Potri.T063300.1
Potri.006G164800.1
Prunus persicappa004285mppa005382m
Ricinus communis29912.m005431
Setaria italicaSi001058m
Selaginella moellendorffii74622
Sorghum bicolorSb03g043150.1
Thellungiella halophilaThhalv10001962m
Vitis viniferaGSVIVT01015303001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny