y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGossypium raimondii
Cazyme IDGorai.009G053900.1
FamilyGH18
Protein PropertiesLength: 777 Molecular Weight: 87183.7 Isoelectric Point: 8.6781
ChromosomeChromosome/Scaffold: 09 Start: 3903516 End: 3907174
Descriptioncysteine-rich RLK (RECEPTOR-like protein kinase) 5
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH18303660
  AGYWYASGEFPIQDINSALFTHLSYAFADVNASNYQLLIPSASQQYLSTFPTIVKRRNPSVKPLLSIWNGISATGKSIAGENVTDSVLSSMVSASSKRKS
  FIDSSIKTARRYGFQGMDLFWVWPNSTDLSNIGVLLDEWRAAINSEQRQPGESQLILTLAIRYLPTIEMVSYPIDSIRRNVDWAHVVAYDYHLPTRENFT
  GLHAALYNPSSNVNTDFGIREWLNKGMPPSKLVLGLPYHGYAWKLVSSQDNAIGAPSSGPAVNIDGSMGYKAIKSYIRDYGYGATSVYNATYVVNLLTTP
  TIWINFDDVETIKAKMSYVKEKKLIGFKAFQLSNDDN
Full Sequence
Protein Sequence     Length: 777     Download
MASKIIFFFL FILFPSSQFH LCGAQTLVKA GYWYASGEFP IQDINSALFT HLSYAFADVN    60
ASNYQLLIPS ASQQYLSTFP TIVKRRNPSV KPLLSIWNGI SATGKSIAGE NVTDSVLSSM    120
VSASSKRKSF IDSSIKTARR YGFQGMDLFW VWPNSTDLSN IGVLLDEWRA AINSEQRQPG    180
ESQLILTLAI RYLPTIEMVS YPIDSIRRNV DWAHVVAYDY HLPTRENFTG LHAALYNPSS    240
NVNTDFGIRE WLNKGMPPSK LVLGLPYHGY AWKLVSSQDN AIGAPSSGPA VNIDGSMGYK    300
AIKSYIRDYG YGATSVYNAT YVVNLLTTPT IWINFDDVET IKAKMSYVKE KKLIGFKAFQ    360
LSNDDNWVLS RAAQEGENQA NKQQLLLKII LPVSLIVILA VALLFYLRRR KVQSEAEMVL    420
TSIPSPRINA PAAENFGSDA SHLQVFKFAN IKGATNNFSS ANKLGEGGFG PVYKGKLPGG    480
QEIAVKRLSR TSTQGHEEFQ NEVTLTARLQ HVNLVRLLGY CTEKEEKLLI YEFMPNKSLE    540
LYLFDPVRRY VLDWEKRVRI IEGVTQGLLY LQEYSNITVI HRDLKASNIL LDCDMNPKIS    600
DFGMARLFKK DVNEANTGRI VGTYGYVPPE YVRKGIYSMK YDVYSFGVLL LQIISGKRNT    660
CYYGPQENLN LLEYAYELWS DDRGTEFIDT SLDDSSSTCK IMRCMQIALL CVQENPENRP    720
TMLEVFSMLK NASMAATTPR RPAFSVKADK NTGSTSASQQ EICSFNDPQI SQLEPR*       780
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00180PKc4.0e-47464729270+
cd02872GH18_chitolectin_chitotriosidase1.0e-5437365350+
pfam00704Glyco_hydro_182.0e-6224364348+
smart00636Glyco_186.0e-7028364357+
cd02879GH18_plant_chitinase_class_V9.0e-11125370352+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0005975carbohydrate metabolic process
GO:0006468protein phosphorylation
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI35714.1017763961130unnamed protein product [Vitis vinifera]
RefSeqXP_002263709.102477622764PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002263792.1017761753PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002270006.102477622765PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002324558.1017761763predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3aqu_D0253752341A Chain A, Crystal Structure Of A Class V Chitinase From Arabidopsis Thaliana
PDB3aqu_C0253752341A Chain A, Crystal Structure Of A Class V Chitinase From Arabidopsis Thaliana
PDB3aqu_B0253752341A Chain A, Crystal Structure Of A Class V Chitinase From Arabidopsis Thaliana
PDB3aqu_A0253752341A Chain A, Crystal Structure Of A Class V Chitinase From Arabidopsis Thaliana
PDB3alf_A0283754343A Chain A, Crystal Structure Of Class V Chitinase From Nicotiana Tobaccum
Transmembrane Domains
StartEnd
313335
385407
Signal Peptide
Cleavage Site
24
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CX6671782605187770
GO9166912634807420
GT0382933384407770
CX6763702401303690
EC9249142575037590
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_016_00165.1Aquca_019_00180.1Aquca_016_00164.1
Arabidopsis lyrata329582492890492888
Arabidopsis thalianaAT4G19810.1AT4G19800.1AT4G19730.1AT4G19820.1AT4G19760.1
AT4G19750.1AT4G19720.1AT4G19770.1AT4G19740.1
Brachypodium distachyonBradi5g07230.1
Brassica rapaBra020951Bra000892Bra013426
Carica papayaevm.model.supercontig_127.9
Capsella rubellaCarubv10005044mCarubv10005092mCarubv10006448mCarubv10007736mCarubv10007562m
Chlamydomonas reinhardtiig5109.t1Cre13.g570700.t1.3Cre07.g317250.t1.3Cre02.g112400.t1.3
Citrus clementinaCiclev10010729mCiclev10010227mCiclev10008669mCiclev10030182mCiclev10028370m
Ciclev10028151mCiclev10027866mCiclev10007520mCiclev10027910mCiclev10030156m
Ciclev10010726mCiclev10030238mCiclev10010769mCiclev10030037m
Citrus sinensisorange1.1g040415morange1.1g011487morange1.1g037639morange1.1g012216morange1.1g035910m
orange1.1g043488morange1.1g036029morange1.1g012202morange1.1g009209morange1.1g041217m
orange1.1g006211morange1.1g004402morange1.1g040722morange1.1g008332morange1.1g008036m
orange1.1g003932morange1.1g046015morange1.1g041898morange1.1g042934m
Cucumis sativusCucsa.350810.1Cucsa.350800.1Cucsa.350810.2Cucsa.350820.1Cucsa.132610.1
Eucalyptus grandisEucgr.L02946.1Eucgr.C01666.1Eucgr.L00615.1Eucgr.C01980.1Eucgr.C01669.1
Eucgr.C04060.1Eucgr.C01979.1Eucgr.C04051.1Eucgr.C01977.1Eucgr.C01978.1
Eucgr.C00400.1Eucgr.C00393.1Eucgr.C00395.1Eucgr.C00386.1Eucgr.L01120.1
Eucgr.C00398.1Eucgr.C00392.1Eucgr.C00394.1Eucgr.C00396.1Eucgr.C00389.1
Eucgr.C00399.1Eucgr.C00397.1.210.504Eucgr.C00397.1.210.504Eucgr.C00397.1.52.165Eucgr.C00397.1.52.165
Eucgr.C00383.1Eucgr.C00384.1
Fragaria vescamrna15030.1-v1.0-hybridmrna30870.1-v1.0-hybrid.289.616mrna30870.1-v1.0-hybrid.289.616mrna30875.1-v1.0-hybridmrna10038.1-v1.0-hybrid.101.430
mrna10038.1-v1.0-hybrid.101.430mrna10038.1-v1.0-hybrid.101.430mrna30873.1-v1.0-hybridmrna10035.1-v1.0-hybridmrna10037.1-v1.0-hybrid
mrna10038.1-v1.0-hybrid.439.685mrna10038.1-v1.0-hybrid.439.685mrna10038.1-v1.0-hybrid.439.685
Glycine maxGlyma17g33190.1Glyma17g11170.1Glyma13g22350.1Glyma15g25022.1Glyma17g08400.1
Glyma15g25060.1
Gossypium raimondiiGorai.010G243800.1Gorai.013G217700.1Gorai.001G030000.1Gorai.009G053800.1Gorai.001G030400.1
Gorai.001G030200.2Gorai.001G030200.1Gorai.001G030300.2Gorai.001G030300.1Gorai.009G053900.5
Gorai.009G053900.4Gorai.009G053900.3Gorai.001G030100.1Gorai.013G217600.1Gorai.013G217500.1
Gorai.009G053900.2
Linum usitatissimumLus10017124Lus10018329Lus10036311Lus10019060Lus10040021
Lus10036306Lus10019061Lus10036315Lus10036310Lus10041639
Lus10024081
Malus domesticaMDP0000314088MDP0000296520MDP0000513880MDP0000210039MDP0000598998
MDP0000285243MDP0000246155MDP0000260402MDP0000211807MDP0000162506
MDP0000304868MDP0000304618
Manihot esculentacassava4.1_009774mcassava4.1_026732mcassava4.1_031107mcassava4.1_010113mcassava4.1_023806m
Mimulus guttatusmgv1a022475mmgv1a024913m
Oryza sativaLOC_Os11g27400.1LOC_Os04g30770.1
Panicum virgatumPavirv00022804mPavirv00061630mPavirv00036087m
Physcomitrella patensPp1s144_96V6.1Pp1s390_12V6.1Pp1s4666_1V6.1Pp1s2609_1V6.1
Phaseolus vulgarisPhvul.001G046400.1Phvul.003G158800.1Phvul.003G158500.1Phvul.003G158600.1Phvul.003G158700.1
Picea abiesMA_10427204g0010MA_124661g0010MA_126635g0010MA_31969g0010MA_3523814g0010
MA_4925966g0010MA_8321404g0010MA_83505g0010MA_4827640g0010
Populus trichocarpaPotri.018G112000.2Potri.018G112000.1Potri.018G112100.2Potri.018G112100.1Potri.006G261800.1
Potri.006G188300.1Potri.006G188400.1Potri.018G111900.2Potri.018G111900.1Potri.018G111600.2
Potri.018G111600.1Potri.018G111700.1Potri.018G111800.1
Prunus persicappa020347mppa007414mppa019682mppa002009mppa007396m
ppa002019mppa018340mppa017872mppa020647m
Ricinus communis29737.m00123929848.m00456029737.m00123429737.m00123529737.m001238
29737.m001236
Setaria italicaSi026355mSi010200m
Selaginella moellendorffii11003141007141007255473
Sorghum bicolorSb05g012300.1Sb06g011080.1
Thellungiella halophilaThhalv10025464m
Vitis viniferaGSVIVT01001059001GSVIVT01001058001GSVIVT01003718001GSVIVT01001068001GSVIVT01001064001
GSVIVT01001074001GSVIVT01007371001.422.716GSVIVT01007371001.422.716GSVIVT01007371001.116.299GSVIVT01007371001.116.299
GSVIVT01001061001
Volvox carteriVocar20012894m
Zea maysAC211652.4_FGT003
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)