Basic Information | |
---|---|
Species | Gossypium raimondii |
Cazyme ID | Gorai.009G104500.11 |
Family | AA2 |
Protein Properties | Length: 185 Molecular Weight: 20422.3 Isoelectric Point: 5.9295 |
Chromosome | Chromosome/Scaffold: 09 Start: 7574409 End: 7577019 |
Description | ascorbate peroxidase 1 |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
AA2 | 68 | 180 | 1.2e-28 |
PRVRSDHLRQVFSAQMGLSDQDIVALSGGHTLGRCHKERSGFEGPWTTNPLIFDNSYFKELLSGEKEGLLQLPTDKVLLSDPVFRPLVEKYAADEDAFFA DYTEAHLKLSELG |
Full Sequence |
---|
Protein Sequence Length: 185 Download |
MLLTTALISP SDFSSRSRSS SLTSPTLTSI SLLVSSPLRL LVDLKFPSIP EERTSLTHHL 60 RAVFLMLPRV RSDHLRQVFS AQMGLSDQDI VALSGGHTLG RCHKERSGFE GPWTTNPLIF 120 DNSYFKELLS GEKEGLLQLP TDKVLLSDPV FRPLVEKYAA DEDAFFADYT EAHLKLSELG 180 FADA* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
cd00314 | plant_peroxidase_like | 4.0e-11 | 73 | 157 | 101 | + Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase. | ||
PLN02364 | PLN02364 | 1.0e-39 | 73 | 184 | 112 | + L-ascorbate peroxidase 1 | ||
PLN02879 | PLN02879 | 2.0e-40 | 73 | 183 | 111 | + L-ascorbate peroxidase | ||
PLN02608 | PLN02608 | 1.0e-41 | 74 | 181 | 108 | + L-ascorbate peroxidase | ||
cd00691 | ascorbate_peroxidase | 1.0e-46 | 73 | 184 | 116 | + Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004601 | peroxidase activity |
GO:0006979 | response to oxidative stress |
GO:0020037 | heme binding |
GO:0055114 | oxidation-reduction process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | AAZ20282.1 | 0 | 51 | 184 | 118 | 247 | cytosolic ascorbate peroxidase [Arachis hypogaea] |
GenBank | ABR18607.1 | 0 | 72 | 184 | 138 | 250 | cytosolic ascorbate peroxidase 1 [Gossypium hirsutum] |
GenBank | ACJ11731.1 | 0 | 72 | 184 | 138 | 250 | ascorbate peroxidase [Gossypium hirsutum] |
GenBank | ACN91229.1 | 0 | 72 | 184 | 138 | 250 | cytosolic ascorbate peroxidase [Gossypium hirsutum] |
GenBank | ADC95633.1 | 0 | 72 | 184 | 138 | 250 | L-ascorbate peroxidase [Bruguiera gymnorhiza] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3zcy_A | 0 | 72 | 184 | 137 | 249 | A Chain A, Ascorbate Peroxidase W41a-h42y Mutant |
PDB | 3zch_A | 0 | 72 | 184 | 149 | 261 | A Chain A, Ascorbate Peroxidase W41a-h42m Mutant |
PDB | 3zcg_A | 0 | 72 | 184 | 149 | 261 | A Chain A, Ascorbate Peroxidase W41a-h42c Mutant |
PDB | 2wd4_A | 0 | 72 | 184 | 149 | 261 | A Chain A, Ascorbate Peroxidase W41a-h42c Mutant |
PDB | 2vo2_X | 0 | 72 | 184 | 149 | 261 | A Chain A, Ascorbate Peroxidase W41a-h42c Mutant |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
ES832403 | 141 | 45 | 185 | 0 |
CF966919 | 135 | 51 | 185 | 0 |
BQ412652 | 143 | 45 | 185 | 0 |
BQ415864 | 141 | 47 | 185 | 0 |
ES812001 | 134 | 52 | 185 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|